DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:414 Identity:103/414 - (24%)
Similarity:167/414 - (40%) Gaps:84/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 ESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEV 161
            ::.||.:..|.:.|..:.|........|::   |..|....|....||      :|:|..:.|.|
  Fly    11 QTCALSVILLLILMSQQCYPQRVEVPAEVI---VDPKFSSPIVNMTAP------VGRDAFLTCVV 66

  Fly   162 KADPNP-TIDWLRNGDPIRTTNDKYVVQTN-------------GLLIRNVQESDEGIYTCRAAVI 212
            : |..| .:.|||.......|...:|:..|             .:.|::::|||:|.|.|:   |
  Fly    67 Q-DLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQ---I 127

  Fly   213 ETGELLERTIRVEVFIQPEIISLPTNLEAV--EGKPFAANCTARGKPVPEISWIRDA-TQLNVAT 274
            .|..:..:...::|.:.|:|:..||:.:.|  ||......|.|.|.|.|.|:|.|:: ..:.:||
  Fly   128 NTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELAT 192

  Fly   275 ADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGV---VDQKTKLNVLVRPQIYELYNVTGA-R 335
            .:.......|.|| |.:|.:...|.|.|:|.|  ||   |.::..|.|...|.|.....:.|| .
  Fly   193 GEEVMSIEGTDLV-IPNVRRHHMGAYLCIASN--GVPPSVSKRITLVVHFPPMITVQNQLIGAVE 254

  Fly   336 TKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEP------NFDEERG-ESTGTLR 393
            .|.:.:.|.::..|.   :...| |:|   .|:       |:.|      |..|..| .::..|.
  Fly   255 GKGVTLDCESEAYPK---SINYW-TRE---RGE-------IVPPGGKYSANVTEIGGYRNSMRLH 305

  Fly   394 ISNAERSDDGLYQCIARNKGADA------YKTGHITVEFAPDF--------------SHMKELPP 438
            |:...:::.|.|:|:|:|...|.      |:.....|.:..:|              ||......
  Fly   306 INPLTQAEFGSYRCVAKNSLGDTDGTIKLYRIPPNAVNYVENFEARHKGKKRTKSSESHHPARAQ 370

  Fly   439 VFSWE------QRKANLSCLAMGI 456
            ..|.|      :|||:||..|..|
  Fly   371 EHSGEDMENPGKRKADLSLGAESI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 7/35 (20%)
IG_like 144..226 CDD:214653 22/95 (23%)
IGc2 152..209 CDD:197706 19/70 (27%)
I-set 230..319 CDD:254352 31/94 (33%)
IGc2 243..309 CDD:197706 22/66 (33%)
IG_like 330..424 CDD:214653 23/107 (21%)
IGc2 339..412 CDD:197706 17/79 (22%)
Ig 447..518 CDD:143165 5/10 (50%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 23/99 (23%)
IG_like 51..137 CDD:214653 23/95 (24%)
IG_like 153..237 CDD:214653 27/86 (31%)
Ig 161..224 CDD:299845 21/65 (32%)
IG_like 252..335 CDD:214653 21/96 (22%)
Ig 258..333 CDD:143165 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.