DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr3

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:211 Identity:44/211 - (20%)
Similarity:70/211 - (33%) Gaps:67/211 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VVMCEVKADPNPTIDWLRNGD----PIRT---TNDKYVVQTNG-------LLIRNVQESDEGIYT 206
            ::.|.|.:..:.::.|:|..|    .:.|   |:||....|..       |.::.....|.|||.
  Fly   256 IIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYE 320

  Fly   207 CRAAVIETGELLERTIRVEVF-IQPE---IISLPTNLEAVEGKPFAANCTARGKPVPEIS---WI 264
            |:   :.|...:....::.:. |.|:   :||.|.:|....|.....||..:...|.:|.   |.
  Fly   321 CQ---VNTEPKMS
MAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIYWY 382

  Fly   265 R--------DA------------------------------TQLNVATADRFQVNPQTG-----L 286
            |        ||                              ..|.:..|.|..:..|.|     .
  Fly   383 RGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSR 447

  Fly   287 VTISSVSQDDYGTYTC 302
            :.||:....|.|.|||
  Fly   448 LRISNAQTTDTGNYTC 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 17/83 (20%)
IGc2 152..209 CDD:197706 16/66 (24%)
I-set 230..319 CDD:254352 26/122 (21%)
IGc2 243..309 CDD:197706 21/106 (20%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr3NP_001014459.2 Ig 243..330 CDD:299845 17/76 (22%)
IG_like 243..329 CDD:214653 17/75 (23%)
Ig 350..464 CDD:299845 23/114 (20%)
IG_like <441..477 CDD:214653 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.