DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and CG33543

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:415 Identity:101/415 - (24%)
Similarity:164/415 - (39%) Gaps:107/415 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLCSCSLIELT-------------------------RAQSPILEIYPKQEVQRKPVGKPLILTC 54
            :.|||..|:.|:                         |..:|.|.:.|........|.:..|:.|
  Fly     5 IALCSLLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFC 69

  Fly    55 RPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTAS 119
            : ||.:.   .|.:|:|.|..|   :.|.:.:  ::.|......|||:...:::|..|.:.|..:
  Fly    70 Q-TVQKD---IDTKWRDPRGQT---RENTKGR--VHIEKKTTGLLALVFEHIALEDRGNWTCEVN 125

  Fly   120 ---------------YANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTI 169
                           .|:.|:|   |..|    |::....:.|....|:|.:|.|.|:..|.|.:
  Fly   126 GNRNGNRNVNVEREFLASFELL---VNQK----ISFGKTEQVQSVREGRDAMVNCFVEGMPAPEV 183

  Fly   170 DWLRNGDPIRTTND-KYVVQTNGLLIRNVQESDEGIYTCRAAVI-----ETGELLERTIRVEVFI 228
            .||.||:.|.|.|. |:...:|||.||||.::|.|.|||||..|     ::.::   ||.:.:..
  Fly   184 SWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQI---TILLRIQH 245

  Fly   229 QPEII---SLPTNLEAVEGKPFAAN--CTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVT 288
            :|...   :||.....|.|   |.|  |.|.|:|.|..:|:.:...: |....|..|......:.
  Fly   246 KPHWFFNETLPVQYAYVGG---AVNLSCDAMGEPPPSFTWLHNNKGI-VGFNHRIFVADYGATLQ 306

  Fly   289 ISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAP-A 352
            :...:...:|.|.|...|..|::::..||                              ||.| .
  Fly   307 LQMKNASQFGDYKCKVANPLGMLERVIKL------------------------------RPGPKP 341

  Fly   353 ITFRRWGTQEEYTNGQQDD--DPRI 375
            :..||:..::.||||.:.|  .||:
  Fly   342 LGPRRFQLKKLYTNGFELDIQTPRM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 22/108 (20%)
IG_like 144..226 CDD:214653 33/87 (38%)
IGc2 152..209 CDD:197706 27/57 (47%)
I-set 230..319 CDD:254352 23/93 (25%)
IGc2 243..309 CDD:197706 16/67 (24%)
IG_like 330..424 CDD:214653 12/49 (24%)
IGc2 339..412 CDD:197706 12/40 (30%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 27/58 (47%)
IG_like 256..336 CDD:214653 21/113 (19%)
IGc2 263..327 CDD:197706 16/67 (24%)
FN3 341..445 CDD:238020 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11470
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.