DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and CG33543

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:415 Identity:101/415 - (24%)
Similarity:164/415 - (39%) Gaps:107/415 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLCSCSLIELT-------------------------RAQSPILEIYPKQEVQRKPVGKPLILTC 54
            :.|||..|:.|:                         |..:|.|.:.|........|.:..|:.|
  Fly     5 IALCSLLLLLLSQNAAILGQLDSTSSGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFC 69

  Fly    55 RPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTAS 119
            : ||.:.   .|.:|:|.|..|   :.|.:.:  ::.|......|||:...:::|..|.:.|..:
  Fly    70 Q-TVQKD---IDTKWRDPRGQT---RENTKGR--VHIEKKTTGLLALVFEHIALEDRGNWTCEVN 125

  Fly   120 ---------------YANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTI 169
                           .|:.|:|   |..|    |::....:.|....|:|.:|.|.|:..|.|.:
  Fly   126 GNRNGNRNVNVEREFLASFELL---VNQK----ISFGKTEQVQSVREGRDAMVNCFVEGMPAPEV 183

  Fly   170 DWLRNGDPIRTTND-KYVVQTNGLLIRNVQESDEGIYTCRAAVI-----ETGELLERTIRVEVFI 228
            .||.||:.|.|.|. |:...:|||.||||.::|.|.|||||..|     ::.::   ||.:.:..
  Fly   184 SWLYNGEYINTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQI---TILLRIQH 245

  Fly   229 QPEII---SLPTNLEAVEGKPFAAN--CTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVT 288
            :|...   :||.....|.|   |.|  |.|.|:|.|..:|:.:...: |....|..|......:.
  Fly   246 KPHWFFNETLPVQYAYVGG---AVNLSCDAMGEPPPSFTWLHNNKGI-VGFNHRIFVADYGATLQ 306

  Fly   289 ISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAP-A 352
            :...:...:|.|.|...|..|::::..||                              ||.| .
  Fly   307 LQMKNASQFGDYKCKVANPLGMLERVIKL------------------------------RPGPKP 341

  Fly   353 ITFRRWGTQEEYTNGQQDD--DPRI 375
            :..||:..::.||||.:.|  .||:
  Fly   342 LGPRRFQLKKLYTNGFELDIQTPRM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 20/102 (20%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 3/3 (100%)
Ig strand F 113..118 CDD:409353 1/4 (25%)
Ig 139..209 CDD:472250 28/70 (40%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 3/3 (100%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 23/94 (24%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 3/9 (33%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 3/7 (43%)
Ig strand G 309..319 CDD:409568 3/9 (33%)
IG_like 330..424 CDD:214653 12/49 (24%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 388..394 CDD:409353
Ig strand F 404..409 CDD:409353
Ig 447..515 CDD:409353
Ig strand B 447..451 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 487..491 CDD:409353
Ig strand F 501..506 CDD:409353
FN3 525..619 CDD:238020
FN3 640..735 CDD:238020
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 14/59 (24%)
Ig strand E 105..109 CDD:409353 3/3 (100%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 31/88 (35%)
Ig strand B 169..173 CDD:409353 1/3 (33%)
Ig strand C 182..186 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 3/3 (100%)
Ig strand F 219..224 CDD:409353 3/4 (75%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
IG_like 256..336 CDD:214653 21/113 (19%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 0/6 (0%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.