Sequence 1: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 306 | Identity: | 80/306 - (26%) |
---|---|---|---|
Similarity: | 129/306 - (42%) | Gaps: | 46/306 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 ILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKY---- 185
Fly 186 --VVQTN-----GLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQ--PEIISLPTNLEA 241
Fly 242 VEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKN 306
Fly 307 RAGVVD-QKTKLNVLVRPQIYELYNVTGARTKEIAI-TCRAKGRPAPAITFRRWGTQEEYTNGQQ 369
Fly 370 DDDPRIILEPNFDEERGESTG---TLRISNAERSDDGLYQCIARNK 412 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | 2/7 (29%) |
IG_like | 144..226 | CDD:214653 | 23/92 (25%) | ||
IGc2 | 152..209 | CDD:197706 | 18/67 (27%) | ||
I-set | 230..319 | CDD:254352 | 24/89 (27%) | ||
IGc2 | 243..309 | CDD:197706 | 19/65 (29%) | ||
IG_like | 330..424 | CDD:214653 | 24/87 (28%) | ||
IGc2 | 339..412 | CDD:197706 | 19/76 (25%) | ||
Ig | 447..518 | CDD:143165 | |||
fn3 | 534..611 | CDD:278470 | |||
FN3 | 640..735 | CDD:238020 | |||
Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 23/92 (25%) |
Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 51..59 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 59..63 | CDD:409353 | 1/4 (25%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 3/11 (27%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 2/2 (100%) | ||
FR3 | 84..118 | CDD:409353 | 10/36 (28%) | ||
Ig strand D | 87..94 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 5/10 (50%) | ||
CDR3 | 119..123 | CDD:409353 | 1/4 (25%) | ||
Ig strand G | 123..132 | CDD:409353 | 3/8 (38%) | ||
FR4 | 125..132 | CDD:409353 | 3/6 (50%) | ||
Ig_3 | 135..206 | CDD:404760 | 20/76 (26%) | ||
Ig strand A | 135..138 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 165..170 | CDD:409353 | 2/8 (25%) | ||
Ig strand C' | 171..174 | CDD:409353 | 1/2 (50%) | ||
Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
Ig_3 | 223..300 | CDD:404760 | 24/92 (26%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |