DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Opcml

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:306 Identity:80/306 - (26%)
Similarity:129/306 - (42%) Gaps:46/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKY---- 185
            ::..||.:::..| |:..|.:|.....|:...:.|.:. |....:.||.....:...|||:    
Mouse    24 LVPTGVPVRSGDA-TFPKAMDNVTVRQGESATLRCTID-DRVTRVAWLNRSTILYAGNDKWSIDP 86

  Fly   186 --VVQTN-----GLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQ--PEIISLPTNLEA 241
              ::..|     .::|:||...|||.|||.   ::| :...:|.||.:.:|  |:|:::.:::..
Mouse    87 RVIILVNTPTQYSIMIQNVDVYDEGPYTCS---VQT-DNHPKTSRVHLIVQVPPQIMNISSDITV 147

  Fly   242 VEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKN 306
            .||......|.|.|:|.|.::|    ..|:|.....|....:  .:.||.:.:|..|.|.|.|.|
Mouse   148 NEGSSVTLLCLAIGRPEPTVTW----RHLSVKEGQGFVSEDE--YLEISDIKRDQSGEYECSALN 206

  Fly   307 RAGVVD-QKTKLNVLVRPQIYELYNVTGARTKEIAI-TCRAKGRPAPAITFRRWGTQEEYTNGQQ 369
            .....| :|.|:.|...|.|.:..| ||....:..| :|.|...|.....:.:            
Mouse   207 DVAAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFK------------ 258

  Fly   370 DDDPRIILEPNFDEERGESTG---TLRISNAERSDDGLYQCIARNK 412
             :|.|  |....|..|.|:.|   ||...|....|.|.|.|:|.||
Mouse   259 -EDTR--LATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 2/7 (29%)
IG_like 144..226 CDD:214653 23/92 (25%)
IGc2 152..209 CDD:197706 18/67 (27%)
I-set 230..319 CDD:254352 24/89 (27%)
IGc2 243..309 CDD:197706 19/65 (29%)
IG_like 330..424 CDD:214653 24/87 (28%)
IGc2 339..412 CDD:197706 19/76 (25%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 23/92 (25%)
Ig strand A' 44..49 CDD:409353 1/4 (25%)
Ig strand B 51..59 CDD:409353 1/7 (14%)
CDR1 59..63 CDD:409353 1/4 (25%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 3/11 (27%)
Ig strand C' 72..76 CDD:409353 0/3 (0%)
Ig strand C' 80..83 CDD:409353 2/2 (100%)
FR3 84..118 CDD:409353 10/36 (28%)
Ig strand D 87..94 CDD:409353 0/6 (0%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 5/10 (50%)
CDR3 119..123 CDD:409353 1/4 (25%)
Ig strand G 123..132 CDD:409353 3/8 (38%)
FR4 125..132 CDD:409353 3/6 (50%)
Ig_3 135..206 CDD:404760 20/76 (26%)
Ig strand A 135..138 CDD:409353 1/2 (50%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 1/8 (13%)
Ig strand C 165..170 CDD:409353 2/8 (25%)
Ig strand C' 171..174 CDD:409353 1/2 (50%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 24/92 (26%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.