DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr18

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:387 Identity:77/387 - (19%)
Similarity:123/387 - (31%) Gaps:139/387 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGK-------YYCTASYANTEILEKG 129
            |..::.:|....|.:.||.|   || |:.....||.::..|.       ...|.::|:.::... 
  Fly   119 NAPHSPIPTKMSRGKIPMET---PG-SMEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLKVDRS- 178

  Fly   130 VTIKTYVAIT-----W--------TNAPENQY----------------PTLGQ----------DY 155
             |:|..:..|     |        |..|.:::                .|.|.          :.
  Fly   179 -TMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEA 242

  Fly   156 VVMCEVKADPNPTIDWLR----------------NGDP-IRTTNDKYVVQTN-GLLIRNVQESDE 202
            |:.|.|....:.|:.|:|                :||| ||.   |:....| .|||...|..|.
  Fly   243 VLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRV---KFQYPNNWRLLINPTQTEDA 304

  Fly   203 GIYTCRAA-----VIETG-ELLERTIRV--------------------------EVFIQPE---- 231
            |:|.|:.:     |..|. .:||..:|:                          ..|.|.|    
  Fly   305 GVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTI 369

  Fly   232 IISLPTNLEAVE-------------GKPFAANCTARGKPVPE-----ISWIRDATQLNVATADRF 278
            :.|..:..:||:             |..........|:.:.:     |:|.:|...|...|..|.
  Fly   370 LKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRL 434

  Fly   279 QVNP--QTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKL----------NVLVRPQIYEL 328
            .|:.  .|..::|......|.|.|:|.......|:.|...|          |:..|.:||.|
  Fly   435 SVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 15/67 (22%)
IG_like 144..226 CDD:214653 29/157 (18%)
IGc2 152..209 CDD:197706 22/84 (26%)
I-set 230..319 CDD:254352 22/122 (18%)
IGc2 243..309 CDD:197706 15/85 (18%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr18NP_573102.1 IG_like 242..325 CDD:214653 23/85 (27%)
Ig <258..326 CDD:299845 19/70 (27%)
IGc2 <417..461 CDD:197706 12/43 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.