DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr14

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:264 Identity:56/264 - (21%)
Similarity:97/264 - (36%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 WTNAPENQ------------YPTLGQDYVVM-------------CEVKADPNPTIDWL-RNGDPI 178
            :|:.||::            :|.....|..:             |.|......|:.|: |.||.:
  Fly    52 FTDTPEDEELEVTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDL 116

  Fly   179 R---------TTNDKYVVQTN-----GLLIRNVQESDEGIYTCRAA-----VIETGELLERTIRV 224
            .         :.:.:|.::..     .|||:...|.|||.|.|:.:     |:    |:..||  
  Fly   117 TLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVL----LVYLTI-- 175

  Fly   225 EVFIQPEIISLPTNLEAVEGKPFAA------NCTARGKPVPE--ISWIRDATQLNVATADRFQVN 281
               |.|.:..|.....|...|.:.|      .|.....|.|.  |:|......||..|: |..::
  Fly   176 ---IVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTS-RGGIS 236

  Fly   282 PQTGLVT--------ISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKE 338
            .:|.::.        |::.::.|.|.|||:..|.   :.:...::||...:...:.:..|:|.|.
  Fly   237 VKTDMLPGRALSRLYIANANRQDTGNYTCMLGNE---ITETVVVHVLNGEEPAAMQHANGSRQKA 298

  Fly   339 IAIT 342
            .|.|
  Fly   299 NAST 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 25/126 (20%)
IGc2 152..209 CDD:197706 18/84 (21%)
I-set 230..319 CDD:254352 22/104 (21%)
IGc2 243..309 CDD:197706 19/81 (23%)
IG_like 330..424 CDD:214653 5/13 (38%)
IGc2 339..412 CDD:197706 2/4 (50%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 17/79 (22%)
Ig 84..169 CDD:299845 17/84 (20%)
IG_like 191..279 CDD:214653 19/91 (21%)
Ig 201..274 CDD:143165 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.