DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Prtg

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001032740.2 Gene:Prtg / 315806 RGDID:1307157 Length:1193 Species:Rattus norvegicus


Alignment Length:747 Identity:171/747 - (22%)
Similarity:269/747 - (36%) Gaps:213/747 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLI------RNVQESDE 202
            |::...|......:.|:...:....:.||:||..: :.|.:..|.:||.|.      |..::|||
  Rat    39 PQDATVTRKDPVFLDCQAHGEGPIKVTWLKNGAKL-SENKRIQVLSNGSLYISEAEGRRGEQSDE 102

  Fly   203 GIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDA 267
            |.|.| .||.:.|.:|.:...:.:.........|.:.|..||.....:|.....|...|:|..:.
  Rat   103 GFYQC-LAVNKYGAILSQKAHLTLSTISAFEVHPVSTEVPEGGVARFSCKISSTPPAVITWEFNR 166

  Fly   268 TQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAG-----------VVDQKTKL---- 317
            |.|.:....|....| :|::.|.....:|.|.|.|:|...|.           |...:|:.    
  Rat   167 TALPMTMDSRVTALP-SGVLQIYDAGPEDAGKYRCVAATHAHKRKSMEASLTIVPANETRSFYMP 230

  Fly   318 NVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFD 382
            .::..||     |||.:..:.:.:.|.|.|.|.|.|::.|.             |.:.|   :..
  Rat   231 TIIASPQ-----NVTASLHQTVVLECMATGYPKPIISWSRL-------------DHKSI---DVF 274

  Fly   383 EERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKEL-PPVF-SWEQR 445
            ..|....|.|.||:.:....|:|.|.|...|     |.:.||..|.    :..| ||.| .|.:.
  Rat   275 NTRVLGNGNLIISDVKLQHAGVYVCRATTPG-----TRNFTVAMAT----LTVLAPPSFVEWPES 330

  Fly   446 -------KANLSCLAMGIPNATIEWHWNGRKIKD-----LYDTNLKIVGTGPRSDLIVHPVTRQY 498
                   .|...|.|.|||:..:.|..|||:|..     :|::.|.|....|..|.|        
  Rat   331 LTRPRAGTARFVCQAEGIPSPKMSWLKNGRRIHSNGRIKMYNSKLVINQIIPEDDAI-------- 387

  Fly   499 YSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPS---QLTATTMTFDIRGPSTELGL----PI 556
               |:|:|.|..|:.     |..||:...:||.:||   .:.|.||:......:.|..|    .:
  Rat   388 ---YQCMAENSQGSV-----LSRARLTVVMSEDRPSAPYNVHAETMSSSAILLAWERPLYNSDKV 444

  Fly   557 LAYSVQYKEA-----------------------LNPD-----WSTAY------------------ 575
            :||||.|.:|                       |.||     :..||                  
  Rat   445 IAYSVHYMKAEGLNNEEYQVVLGNDTTHYIIDDLEPDSNYTFYIVAYMPMGASQMSDHVTQNTLE 509

  Fly   576 ------------NR-------SWSP----------------------------DSP-----YIVE 588
                        :|       ||.|                            :.|     |::|
  Rat   510 DVPLRPPEISLTSRSPTDILISWLPIPAKYRRGQVVLYRLSFRLSTENSIQVVELPGTVHEYLLE 574

  Fly   589 GLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHFE 653
            ||.|.:.|..|..|..:||||...|.....||:.::.:.||   :|..|  .||:..:..|    
  Rat   575 GLEPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKAPK---SPELH--LEPLNCTTIS---- 630

  Fly   654 LRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMTQLVGNTYYRIELKA 718
            :||....::...|..|::.|    |..|.........:|.:::.|    ::.|.....|.:.|.|
  Rat   631 VRWLQDTEDPAAIRGYKLFY----KEEGQQEHGPIFLDTGDLLYT----LSGLDPRRKYHVRLLA 687

  Fly   719 HNAI--GYSSPASIIMKTTRGIDVIQVAERQV 748
            :|.:  ||.:..::   :|.|  .:.|.:|.|
  Rat   688 YNNLEDGYQADQTV---STPG--CVSVRDRMV 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353
Ig 139..209 CDD:472250 19/70 (27%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 2/3 (67%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 22/104 (21%)
Ig strand A 229..232 CDD:409568 0/2 (0%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 1/3 (33%)
Ig strand C' 267..270 CDD:409568 1/2 (50%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 2/24 (8%)
IG_like 330..424 CDD:214653 23/93 (25%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 22/72 (31%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 38/198 (19%)
FN3 640..735 CDD:238020 19/96 (20%)
PrtgNP_001032740.2 Ig 32..124 CDD:472250 23/86 (27%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..67 CDD:409353 0/3 (0%)
Ig strand E 85..89 CDD:409353 2/3 (67%)
Ig strand F 104..109 CDD:409353 2/5 (40%)
Ig strand G 118..121 CDD:409353 0/2 (0%)
Ig 131..218 CDD:472250 20/87 (23%)
Ig strand B 146..150 CDD:409353 0/3 (0%)
Ig strand C 159..163 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 230..302 CDD:464046 22/92 (24%)
I-set 322..407 CDD:400151 28/100 (28%)
Ig strand B 340..343 CDD:409353 0/2 (0%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 373..377 CDD:409353 1/3 (33%)
Ig strand F 387..392 CDD:409353 3/15 (20%)
Ig strand G 400..403 CDD:409353 1/2 (50%)
FN3 414..507 CDD:238020 18/92 (20%)
FN3 512..605 CDD:238020 18/92 (20%)
fn3 619..694 CDD:394996 18/88 (20%)
FN3 <723..>931 CDD:442628
FN3 816..906 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..1018
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1078..1193
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.