DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Iglon5

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_218634.5 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:322 Identity:81/322 - (25%)
Similarity:128/322 - (39%) Gaps:49/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 AVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVAT 274
            |||..| ||.:::        |..|...|....||.....:|.. .:.|..::|: :.:.:..|.
  Rat    22 AVISRG-LLSQSL--------EFSSPADNYTVCEGDNATLSCFI-DEHVTRVAWL-NRSNILYAG 75

  Fly   275 ADRFQVNPQTGL---------VTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYN 330
            .||:..:|:..|         :.|:.|...|.|.|||..:.|......:..|.|.|..:|..:.:
  Rat    76 NDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQVYLIVHVPARIVNISS 140

  Fly   331 -VTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRI 394
             |.......:.:.|.|.|||.|.:|:|:                   |...|..| ||   .|.|
  Rat   141 PVAVNEGGNVNLLCLAVGRPEPTVTWRQ-------------------LRDGFTSE-GE---ILEI 182

  Fly   395 SNAERSDDGLYQCIARN--KGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIP 457
            |:.:|...|.|:|:..|  ..|...:...:||.:.|..:.:........   |.|.|.|.||.:|
  Rat   183 SDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALG---RAALLRCEAMAVP 244

  Fly   458 NATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQL 519
            .|..:|:.:.|.:.......||:.....||.|:...|:.::|..|.|.|.|..|.:...|:|
  Rat   245 PADFQWYKDDRLLSSGSAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 6/15 (40%)
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 22/97 (23%)
IGc2 243..309 CDD:197706 18/74 (24%)
IG_like 330..424 CDD:214653 23/96 (24%)
IGc2 339..412 CDD:197706 21/74 (28%)
Ig 447..518 CDD:143165 21/70 (30%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Iglon5XP_218634.5 Ig 41..129 CDD:416386 20/89 (22%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 1/7 (14%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 1/7 (14%)
Ig strand C 61..67 CDD:409353 1/6 (17%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 9/34 (26%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 4/7 (57%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 22/87 (25%)
Ig strand A' 140..145 CDD:409353 1/4 (25%)
Ig strand B 148..157 CDD:409353 1/8 (13%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 1/3 (33%)
Ig strand E 178..183 CDD:409353 2/7 (29%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 21/80 (26%)
putative Ig strand A 218..224 CDD:409353 1/5 (20%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.