DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and MXRA5

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_056234.2 Gene:MXRA5 / 25878 HGNCID:7539 Length:2828 Species:Homo sapiens


Alignment Length:780 Identity:191/780 - (24%)
Similarity:292/780 - (37%) Gaps:211/780 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RKPVGKP-------------------------LILTCRPTVP--------EPSLVADLQWKDNRN 74
            |.|||||                         |.:|.||.:|        |..::.....:.:.:
Human  1711 RNPVGKPPSPRIPHYSNGRLPFFTNKTLSFPQLGVTRRPQIPTSPAPVMRERKVIPGSYNRIHSH 1775

  Fly    75 NT-----------ILPKPNGRNQP-------PMYTETLPGESLALMITSLSVEMGGKYYCTAS-- 119
            :|           :|..|.....|       ||.:.|   :|....||| ||:..|.::.::|  
Human  1776 STFHLDFGPPAPPLLHTPQTTGSPSTNLQNIPMVSST---QSSISFITS-SVQSSGSFHQSSSKF 1836

  Fly   120 YANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLR-NGDPIRTTN- 182
            :|......|..::.....|. |.:|:....|...|.|..||....|.|.:.|.: :...:.|.| 
Human  1837 FAGGPPASKFWSLGEKPQIL-TKSPQTVSVTAETDTVFPCEATGKPKPFVTWTKVSTGALMTPNT 1900

  Fly   183 --DKYVVQTNG-LLIRNVQESDEGIYTCRAAVIETGE----LLERTIRVEVFIQPEII-SLPTNL 239
              .::.|..|| |:||.||..|.|.|.|.|:.:...:    ||..|::     ||:|: |...::
Human  1901 RIQRFEVLKNGTLVIRKVQVQDRGQYMCTASNLHGLDRMVVLLSVTVQ-----QPQILASHYQDV 1960

  Fly   240 EAVEGKPFAANCTARGKPVPEISWI---RDATQLNVATADRFQVNPQTGLVT--------ISSVS 293
            ....|...|..|.|:|.|.|:||||   |...|         .|:|..|.:|        |...|
Human  1961 TVYLGDTIAMECLAKGTPAPQISWIFPDRRVWQ---------TVSPVEGRITLHENRTLSIKEAS 2016

  Fly   294 QDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIY---ELYNVTGARTKEIAITCRAKGRPAPAITF 355
            ..|.|.|.|:|.|.||......:|:|...|.:.   :|.|::......|.|.|.||..|.|::  
Human  2017 FSDRGVYKCVASNAAGADSLAIRLHVAALPPVIHQEKLENISLPPGLSIHIHCTAKAAPLPSV-- 2079

  Fly   356 RRW----GTQ---EEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKG 413
             ||    |||   .::.:|      .:.:.||         |||.|.|....|.|.|:|:|.|..
Human  2080 -RWVLGDGTQIRPSQFLHG------NLFVFPN---------GTLYIRNLAPKDSGRYECVAANLV 2128

  Fly   414 ADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKAN--------LSCLAMGIPNATIEWHWNGRKI 470
            ..|.:|..:.|:.|...:.:....|      |:.:        |.|.|.|.|...|.|....:::
Human  2129 GSARRTVQLNVQRAAANARITGTSP------RRTDVRYGGTLKLDCSASGDPWPRILWRLPSKRM 2187

  Fly   471 KDL---YDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHG----TAEHDMQLKEARVPDFV 528
            .|.   :|:.:|:...|   .|:|..||.:....|.|:|.|..|    ..:.|:.:|.|::    
Human  2188 IDALFSFDSRIKVFANG---TLVVKSVTDKDAGDYLCVARNKVGDDYVVLKVDVVMKPAKI---- 2245

  Fly   529 SEAKPSQLTATTMTFDIRGPSTELGL--PILAYSVQYKEALNPDWSTAYNRSWSPDS-----PYI 586
             |.|...........|::......||  |.:::|:       ||.|...:...|.||     .|:
Human  2246 -EHKEENDHKVFYGGDLKVDCVATGLPNPEISWSL-------PDGSLVNSFMQSDDSGGRTKRYV 2302

  Fly   587 V----------EGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEE 641
            |          .|:|.:.:|:  ..|.||||       :.:...|......|..:.|     |..
Human  2303 VFNNGTLYFNEVGMREEGDYT--CFAENQVG-------KDEMRVRVKVVTAPATIRN-----KTY 2353

  Fly   642 PVVVSPYSDHF------------ELRWGVPADNGEPI--DRYQIKYCPGVKI--------SGTWT 684
            ..|..||.|..            ::.|..|.:...|.  ::||| |..|..:        ||.:|
Human  2354 LAVQVPYGDVVTVACEAKGEPMPKVTWLSPTNKVIPTSSEKYQI-YQDGTLLIQKAQRSDSGNYT 2417

  Fly   685  684
            Human  2418  2417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 27/130 (21%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 0/4 (0%)
Ig 139..209 CDD:472250 24/74 (32%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 32/101 (32%)
Ig strand A 229..232 CDD:409568 2/2 (100%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 2/3 (67%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 2/12 (17%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 29/100 (29%)
Ig strand B 339..343 CDD:409353 2/3 (67%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 20/82 (24%)
Ig strand B 447..451 CDD:409353 1/11 (9%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 23/110 (21%)
FN3 640..735 CDD:238020 15/67 (22%)
MXRA5NP_056234.2 leucine-rich repeat 38..55 CDD:275380
LRR <46..>218 CDD:443914
LRR 1 56..77
leucine-rich repeat 57..80 CDD:275380
LRR 2 80..101
leucine-rich repeat 81..104 CDD:275380
LRR 3 104..125
leucine-rich repeat 105..128 CDD:275380
LRR 4 128..149
leucine-rich repeat 129..152 CDD:275380
LRR 5 152..173
leucine-rich repeat 153..184 CDD:275380
LRR 6 184..205
leucine-rich repeat 185..208 CDD:275380
LRRCT 217..>263 CDD:214507
IG_like 486..572 CDD:214653
Ig strand B 497..501 CDD:409353
Ig strand C 510..515 CDD:409353
Ig strand E 538..542 CDD:409353
Ig strand F 552..557 CDD:409353
IG_like 590..668 CDD:214653
Ig strand B 595..599 CDD:409353
Ig strand C 608..612 CDD:409353
Ig strand E 634..638 CDD:409353
Ig strand F 648..653 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..715
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 933..962
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1068..1190
DUF5585 1181..>1561 CDD:465521
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1204..1275
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1367..1389
LRR 7 1410..1434
PHA03247 <1465..1799 CDD:223021 15/87 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1479..1499
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1536..1566
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1579..1603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1669..1689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1700..1719 6/7 (86%)
Ig_3 1852..1932 CDD:464046 26/80 (33%)
Ig 1958..2042 CDD:472250 28/92 (30%)
Ig strand B 1968..1972 CDD:409353 1/3 (33%)
Ig strand C 1981..1985 CDD:409353 2/3 (67%)
Ig strand E 2008..2012 CDD:409353 0/3 (0%)
Ig strand F 2022..2027 CDD:409353 2/4 (50%)
Ig strand G 2035..2038 CDD:409353 0/2 (0%)
Ig 2065..2137 CDD:472250 28/89 (31%)
Ig strand B 2065..2069 CDD:409353 2/3 (67%)
Ig strand C 2078..2082 CDD:409353 1/6 (17%)
Ig strand E 2105..2109 CDD:409353 3/3 (100%)
Ig strand F 2119..2124 CDD:409353 2/4 (50%)
Ig strand G 2133..2136 CDD:409353 1/2 (50%)
Ig_3 2147..2225 CDD:464046 20/86 (23%)
IG_like 2258..2341 CDD:214653 22/98 (22%)
Ig strand C 2274..2278 CDD:409353 0/3 (0%)
Ig strand E 2307..2311 CDD:409353 0/3 (0%)
Ig strand F 2321..2326 CDD:409353 1/6 (17%)
Ig 2356..2431 CDD:472250 15/63 (24%)
Ig strand B 2364..2368 CDD:409353 0/3 (0%)
Ig strand C 2377..2381 CDD:409353 0/3 (0%)
Ig strand E 2401..2405 CDD:409353 1/3 (33%)
Ig strand F 2415..2420 CDD:409353 1/3 (33%)
Ig strand G 2428..2431 CDD:409353
Ig 2457..2535 CDD:472250
Ig strand B 2462..2466 CDD:409353
Ig strand C 2475..2480 CDD:409353
Ig strand E 2501..2505 CDD:409353
Ig strand F 2515..2520 CDD:409353
Ig strand G 2528..2531 CDD:409353
IG_like 2549..2633 CDD:214653
Ig strand B 2560..2564 CDD:409568
Ig strand C 2573..2577 CDD:409568
Ig strand E 2599..2603 CDD:409568
Ig strand F 2613..2618 CDD:409568
Ig strand G 2626..2629 CDD:409568
IG_like 2652..2728 CDD:214653
Ig strand B 2655..2659 CDD:409353
Ig strand C 2668..2672 CDD:409353
Ig strand E 2694..2698 CDD:409353
Ig strand F 2708..2713 CDD:409353
Ig_3 2732..2814 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.