DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and NEGR1

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:291 Identity:83/291 - (28%)
Similarity:123/291 - (42%) Gaps:40/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTN---------- 190
            |...|. |.:|.....|...|:.|.:: |......||.....|....||:.|...          
Human    38 VDFPWA-AVDNMMVRKGDTAVLRCYLE-DGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRD 100

  Fly   191 -GLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQ--PEIISLPTNLEAVEGKPFAANCT 252
             .|.|:||..:|:|.|||......|    .||::|.:.:|  |:|..:..::...||......|.
Human   101 YSLQIQNVDVTDDGPYTCSVQTQHT----PRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCL 161

  Fly   253 ARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVD-QKTK 316
            |.|||.|.|||...:     .:|..|: |.|  .:.|..:::|..|.|.|.|:|.....| :|.|
Human   162 ATGKPEPSISWRHIS-----PSAKPFE-NGQ--YLDIYGITRDQAGEYECSAENDVSFPDVRKVK 218

  Fly   317 LNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNF 381
            :.|...|.|.|:.:.|....:...|.|...|.|.||  |..:..:::..||||.    ||:: ||
Human   219 VVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPA--FEWYKGEKKLFNGQQG----IIIQ-NF 276

  Fly   382 DEERGESTGTLRISNAERSDDGLYQCIARNK 412
                 .:...|.::|..:...|.|.|:|.||
Human   277 -----STRSILTVTNVTQEHFGNYTCVAANK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 24/92 (26%)
IGc2 152..209 CDD:197706 19/67 (28%)
I-set 230..319 CDD:254352 27/89 (30%)
IGc2 243..309 CDD:197706 22/65 (34%)
IG_like 330..424 CDD:214653 24/83 (29%)
IGc2 339..412 CDD:197706 21/72 (29%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
NEGR1NP_776169.2 IG 47..135 CDD:214652 24/92 (26%)
IGc2 152..210 CDD:197706 22/65 (34%)
Ig_3 225..301 CDD:372822 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.