DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Cntn5

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_036010831.1 Gene:Cntn5 / 244682 MGIID:3042287 Length:1434 Species:Mus musculus


Alignment Length:852 Identity:185/852 - (21%)
Similarity:309/852 - (36%) Gaps:224/852 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMG 111
            |:.::|.|.|....|.::  ..|..|...:.:.:.:.|        .:..|:..|.|:.:.....
Mouse   516 GQGVVLMCSPPPHSPEII--YSWVFNEFPSFVAEDSRR--------FISQETGNLYISKVQTSDV 570

  Fly   112 GKYYCTASYA--NTEIL---------EKGV------TIKTYVAITWTNAPENQYPTLGQDYVVMC 159
            |.|.|....|  |..:|         ..||      .|:.:...|.|.|.       |....:.|
Mouse   571 GSYICLVKNAVTNARVLSPPTPLTLRNDGVMGEYEPKIEVHFPFTVTAAK-------GTTVKMEC 628

  Fly   160 EVKADPNPTIDWLR-NG---DPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIE-----TG 215
            ....:|.|||.|:: ||   ...|....:.|::     |.|:|..|.|||.|.|....     .|
Mouse   629 FALGNPVPTITWMKVNGYIPSKSRLRKSQAVLE-----IPNLQLDDAGIYECTAENSRGKNSFRG 688

  Fly   216 ELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQV 280
            :|       ::|..|..:....:.:...|.|....|.|.|||.|...|:::...|    ..:.:|
Mouse   689 QL-------QIFTYPHWVQKLNDTQLDSGSPLQWECKATGKPRPTYRWLKNGAPL----LPQSRV 742

  Fly   281 NPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGA----RTKEIAI 341
            :...|::.|.||:|.|.|.|.|||:|:.|.:....:|.:|..|..:||..|..:    :.:.:.|
Mouse   743 DTVNGILAIQSVNQSDAGMYQCLAENKYGAIYASAELKILASPPSFELNQVKKSIIVTKDRGVLI 807

  Fly   342 TCRAKGRPAPAITFRR-------------WGTQEEYTNG----QQDDDP-----RIILEPNFDEE 384
            .|..:|.|.|||::|:             :.|..:.|.|    .....|     ||.:.|:    
Mouse   808 ECEPQGSPKPAISWRKGDKAVRANKSVSFFSTVVQRTRGTCVVMNGWGPKLARRRIAILPD---- 868

  Fly   385 RGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKAN- 448
                 |:|||.||.::|:|.|.|    :|.:.:.:..|....:.......||.|      ::.. 
Mouse   869 -----GSLRILNASKADEGKYIC----QGVNIFGSAEIIASLSVKEPTRIELTP------KRTEL 918

  Fly   449 -------LSCLAMGIPNATIEWHW--NGRKI----KDLYDTNLKIVGTGPRSDLIVHPVTRQYYS 500
                   |:|.|:...:..:.::|  .|:.|    :..:..|::...:.  :||::..:...:..
Mouse   919 TVGESIVLNCKAIHDASLDVTFYWTLKGQPIDFEKEGGHFENIRAQASS--ADLMIRNILLMHAG 981

  Fly   501 GYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKE 565
            .|.|.......:...:.:|.....|.........::|.:|.|.. ..|:|:...||.:|::|.:.
Mouse   982 RYGCRVQTTADSVSDEAELLVRGPPGPPGVVIVEEITESTATLS-WSPATDNHSPISSYNLQARS 1045

  Fly   566 ALNPDWSTAYNRSWSPDSPYIVEG---------LRPQTEYSFRFAARNQVGLGNWGVNQQQSTPR 621
            ..:..|.|.      ...|.::.|         |.|..||.||..|.|.:|.|:..:..:.....
Mouse  1046 PFSLGWQTV------KTVPEVITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSIPSRMIRTN 1104

  Fly   622 RSAPEEP------------------KPLHNPVQHD-----------------KEEPVVVSP---- 647
            .:.|:..                  :|:....|:.                 ||:.|..|.    
Mouse  1105 EAVPKTAPSNVSGRSGRRHELVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSEASKF 1169

  Fly   648 -YSDH-------FELRWGVPADNGE-------------------PID------------------ 667
             |.|.       ||::.||..:.|:                   |.|                  
Mouse  1170 IYRDESVPPLTPFEVKVGVYNNKGDGPFSQIVVICSAEGEPTAAPTDVTATSVSVSEIFVVWKHV 1234

  Fly   668 RYQIKYCPGVKISGTW--TELENSCNTVEVMETTSFEM-TQLVGNTYYRIELKAHNAIGYSSPAS 729
            :..:....|.:|| .|  ||.|:|..||......||.| |.|.|||.|.:.::|:|..||..|:.
Mouse  1235 KESLGRPQGFEIS-YWKDTEPEDSVETVRTRGNESFVMLTGLEGNTLYHLTVRAYNGAGYGPPSR 1298

  Fly   730 IIMKTTR 736
            ....||:
Mouse  1299 EASTTTK 1305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 14/73 (19%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 22/73 (30%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 2/3 (67%)
Ig strand E 190..194 CDD:409353 0/3 (0%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 26/89 (29%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 28/119 (24%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 11/81 (14%)
Ig strand B 447..451 CDD:409353 1/11 (9%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 24/102 (24%)
FN3 640..735 CDD:238020 36/146 (25%)
Cntn5XP_036010831.1 Integrase_Zn 28..63 CDD:426567
rve 79..172 CDD:459897
IN_DBD_C 243..288 CDD:425747
Ig 404..499 CDD:472250
Ig strand B 425..429 CDD:409353
Ig strand C 438..442 CDD:409353
Ig strand E 461..465 CDD:409353
Ig strand F 476..481 CDD:409353
Ig strand G 490..493 CDD:409353
Ig 508..593 CDD:472250 17/86 (20%)
Ig strand B 519..523 CDD:409353 1/3 (33%)
Ig strand C 533..537 CDD:409353 0/5 (0%)
Ig strand E 558..562 CDD:409353 1/3 (33%)
Ig strand F 572..577 CDD:409353 2/4 (50%)
Ig strand G 588..591 CDD:409353 0/2 (0%)
Ig 606..693 CDD:472250 26/105 (25%)
Ig strand B 624..628 CDD:409353 0/3 (0%)
Ig strand C 637..641 CDD:409353 2/3 (67%)
Ig strand E 658..662 CDD:409353 1/8 (13%)
Ig strand F 672..677 CDD:409353 3/4 (75%)
Ig strand G 685..688 CDD:409353 0/2 (0%)
Ig 698..781 CDD:472250 25/86 (29%)
Ig strand B 713..717 CDD:409353 0/3 (0%)
Ig strand C 726..730 CDD:409353 0/3 (0%)
Ig strand E 747..751 CDD:409353 1/3 (33%)
Ig strand F 761..766 CDD:409353 2/4 (50%)
Ig strand G 774..777 CDD:409353 0/2 (0%)
Ig 786..903 CDD:472250 30/129 (23%)
Ig strand B 805..809 CDD:409353 1/3 (33%)
Ig strand C 818..822 CDD:409353 2/3 (67%)
Ig strand E 869..873 CDD:409353 2/3 (67%)
Ig strand F 883..888 CDD:409353 2/8 (25%)
Ig strand G 896..899 CDD:409353 1/2 (50%)
Ig 905..1006 CDD:472250 15/108 (14%)
Ig strand B 924..928 CDD:409353 1/3 (33%)
Ig strand C 939..943 CDD:409353 0/3 (0%)
Ig strand E 968..972 CDD:409353 2/3 (67%)
Ig strand F 982..987 CDD:409353 2/4 (50%)
Ig strand G 995..998 CDD:409353 0/2 (0%)
FN3 1006..1103 CDD:238020 24/103 (23%)
FN3 <1018..1414 CDD:442628 65/296 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.