Sequence 1: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 322 | Identity: | 81/322 - (25%) |
---|---|---|---|
Similarity: | 128/322 - (39%) | Gaps: | 49/322 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 210 AVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVAT 274
Fly 275 ADRFQVNPQTGL---------VTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYN 330
Fly 331 -VTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRI 394
Fly 395 SNAERSDDGLYQCIARN--KGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIP 457
Fly 458 NATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQL 519 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | |
IG_like | 144..226 | CDD:214653 | 6/15 (40%) | ||
IGc2 | 152..209 | CDD:197706 | |||
I-set | 230..319 | CDD:254352 | 22/97 (23%) | ||
IGc2 | 243..309 | CDD:197706 | 18/74 (24%) | ||
IG_like | 330..424 | CDD:214653 | 23/96 (24%) | ||
IGc2 | 339..412 | CDD:197706 | 21/74 (28%) | ||
Ig | 447..518 | CDD:143165 | 21/70 (30%) | ||
fn3 | 534..611 | CDD:278470 | |||
FN3 | 640..735 | CDD:238020 | |||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 20/89 (22%) |
Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 56..60 | CDD:409353 | 0/4 (0%) | ||
FR2 | 61..68 | CDD:409353 | 1/7 (14%) | ||
Ig strand C | 61..67 | CDD:409353 | 1/6 (17%) | ||
CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
FR3 | 80..115 | CDD:409353 | 9/34 (26%) | ||
Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 4/7 (57%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
Ig strand A | 132..137 | CDD:409353 | 1/4 (25%) | ||
Ig_3 | 134..199 | CDD:404760 | 22/87 (25%) | ||
Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 148..157 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 163..167 | CDD:409353 | 1/3 (33%) | ||
Ig strand D | 174..177 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 178..183 | CDD:409353 | 2/7 (29%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 217..295 | CDD:404760 | 21/80 (26%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |