DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Robo1

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_017172382.1 Gene:Robo1 / 19876 MGIID:1274781 Length:1687 Species:Mus musculus


Alignment Length:754 Identity:180/754 - (23%)
Similarity:285/754 - (37%) Gaps:150/754 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PILEIYPKQEVQRKPVGKPLILTC----RPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYT 91
            |.:..:|...:..|  |:|..|.|    |||   |:    ::|.......    ...::.|..:.
Mouse   101 PRIVEHPSDLIVSK--GEPATLNCKAEGRPT---PT----IEWYKGGERV----ETDKDDPRSHR 152

  Fly    92 ETLPGESLALMITSLSVEMG-------GKYYCTASYANTEILEKGVTIKTYVAI---TWTNAPEN 146
            ..||..||..    |.:..|       |.|.|.|.....|.:....:::  |||   .:...|.:
Mouse   153 MLLPSGSLFF----LRIVHGRKSRPDEGVYICVARNYLGEAVSHNASLE--VAILRDDFRQNPSD 211

  Fly   147 QYPTLGQDYVVMCE-VKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAA 210
            ....:|:..|:.|: .:..|.|||.|.::|.|:...:::..::...|:|...::||.|.|.| ..
Mouse   212 VMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERITIRGGKLMITYTRKSDAGKYVC-VG 275

  Fly   211 VIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATA 275
            ....||.......:.|..:|..:..|:||...........|.|||.|||.:.|.:|..:|   ..
Mouse   276 TNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRKDDGEL---PK 337

  Fly   276 DRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV-----------RPQIYELY 329
            .|:::.....| .|..|:..|.|:|||:|:|..|..:....|.|.|           |.|:..| 
Mouse   338 SRYEIRDDHTL-KIRKVTAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVVKPRDQVVAL- 400

  Fly   330 NVTGARTKEIAITCRAKGRPAPAITFRRWGTQE---EYTNGQQDDDPRIILEPNFDEERGESTGT 391
                .||  :...|.|.|.|.|||.:||.|:|.   .|...|......:           ..||.
Mouse   401 ----GRT--VTFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSV-----------SQTGD 448

  Fly   392 LRISNAERSDDGLYQCIARNKGADAYKTGHITV-EFAPDFSHMKELPPVFSWEQRKAN------- 448
            |.|:|.:|||.|.|.|...|.........::.| :...|     ..|||.  .|...|       
Mouse   449 LTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIAD-----RPPPVI--RQGPVNQTVAVDG 506

  Fly   449 ---LSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYS------GYKC 504
               |||:|.|.|..||.|..:| .:....|:.:|.:.:|         |.:..|:      .|.|
Mouse   507 TLILSCVATGSPAPTILWRKDG-VLVSTQDSRIKQLESG---------VLQIRYAKLGDTGRYTC 561

  Fly   505 IATNIHGTA---------EHDMQLKEAR------VPDFVSEAKPSQLTATTMTFDIRGPSTELGL 554
            .|:...|.|         |..:.::..|      :|...|:.:.:.::..|:|...: |:...|.
Mouse   562 TASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSKNTVTLSWQ-PNLNSGA 625

  Fly   555 PILAYSVQ-YKEALNPDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQS 618
            ...:|.:: :..|....|.||...  .....:.::||:|...|.|...|.|..|:.:   ..|.|
Mouse   626 TPTSYIIEAFSHASGSSWQTAAEN--VKTETFAIKGLKPNAIYLFLVRAANAYGISD---PSQIS 685

  Fly   619 TPRRSAPEEP-----------KPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIK 672
            .|.::....|           :.|.|.|.| ...|.::|  |...|:.|.|. ...:.|..|:|.
Mouse   686 DPVKTQDVPPTSQGVDHKQVQRELGNVVLH-LHNPTILS--SSSVEVHWTVD-QQSQYIQGYKIL 746

  Fly   673 YCPGVKISG--TW------TELENSCNTVEVMETTSFEM 703
            |.|.....|  .|      |..:||....::.:..::|:
Mouse   747 YRPSGASHGESEWLVFEVRTPTKNSVVIPDLRKGVNYEI 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 22/98 (22%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 18/70 (26%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 2/3 (67%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 27/89 (30%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 2/2 (100%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 27/96 (28%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 21/92 (23%)
Ig strand B 447..451 CDD:409353 2/13 (15%)
Ig strand C 460..464 CDD:409353 2/3 (67%)
Ig strand E 487..491 CDD:409353 0/3 (0%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 20/94 (21%)
FN3 640..735 CDD:238020 17/72 (24%)
Robo1XP_017172382.1 IgC_1_Robo 101..199 CDD:409490 24/116 (21%)
Ig strand A 101..105 CDD:409490 1/3 (33%)
Ig strand A' 108..113 CDD:409490 0/4 (0%)
Ig strand B 117..125 CDD:409490 3/7 (43%)
Ig strand C 131..136 CDD:409490 1/8 (13%)
Ig strand C' 139..141 CDD:409490 0/1 (0%)
Ig strand D 152..155 CDD:409490 0/2 (0%)
Ig strand E 158..164 CDD:409490 2/9 (22%)
Ig strand F 176..184 CDD:409490 4/7 (57%)
Ig strand G 187..199 CDD:409490 1/13 (8%)
IgI_2_Robo 206..291 CDD:409389 20/85 (24%)
Ig strand A 206..209 CDD:409389 0/2 (0%)
Ig strand A' 211..215 CDD:409389 0/3 (0%)
Ig strand B 219..226 CDD:409389 2/6 (33%)
Ig strand C 234..239 CDD:409389 3/4 (75%)
Ig strand C' 241..244 CDD:409389 1/2 (50%)
Ig strand D 250..254 CDD:409389 0/3 (0%)
Ig strand E 256..262 CDD:409389 2/5 (40%)
Ig strand F 269..277 CDD:409389 3/8 (38%)
Ig strand G 280..291 CDD:409389 2/10 (20%)
IgI_3_Robo 298..380 CDD:409390 26/85 (31%)
Ig strand A 298..301 CDD:409390 0/2 (0%)
Ig strand A' 303..307 CDD:409390 2/3 (67%)
Ig strand B 310..319 CDD:409390 1/8 (13%)
Ig strand C 325..330 CDD:409390 1/4 (25%)
Ig strand C' 333..336 CDD:409390 1/5 (20%)
Ig strand D 339..344 CDD:409390 1/4 (25%)
Ig strand E 345..352 CDD:409390 2/7 (29%)
Ig strand F 359..367 CDD:409390 5/7 (71%)
Ig strand G 370..380 CDD:409390 2/9 (22%)
IgI_4_Robo 388..485 CDD:409391 31/114 (27%)
Ig strand A 388..392 CDD:409391 0/3 (0%)
Ig strand A' 394..398 CDD:409391 2/3 (67%)
Ig strand B 404..412 CDD:409391 2/7 (29%)
Ig strand C 415..422 CDD:409391 3/6 (50%)
Ig strand C' 424..427 CDD:409391 1/2 (50%)
Ig strand D 440..445 CDD:409391 0/15 (0%)
Ig strand E 447..454 CDD:409391 3/6 (50%)
Ig strand F 460..469 CDD:409391 3/8 (38%)
FN3 461..897 CDD:442628 76/352 (22%)
Ig strand G 471..482 CDD:409391 0/10 (0%)
IgI_5_Robo 492..578 CDD:409544 23/97 (24%)
Ig strand A 492..495 CDD:409544 1/4 (25%)
Ig strand A' 499..502 CDD:409544 1/2 (50%)
Ig strand B 508..515 CDD:409544 3/6 (50%)
Ig strand C 521..526 CDD:409544 3/4 (75%)
Ig strand C' 528..530 CDD:409544 1/2 (50%)
Ig strand D 537..541 CDD:409544 1/3 (33%)
Ig strand E 544..549 CDD:409544 2/13 (15%)
Ig strand F 557..565 CDD:409544 3/7 (43%)
Ig strand G 568..578 CDD:409544 2/9 (22%)
FN3 597..683 CDD:238020 19/91 (21%)

Return to query results.
Submit another query.