DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and zig-3

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:239 Identity:54/239 - (22%)
Similarity:86/239 - (35%) Gaps:60/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IETGELLERTIRVEVFIQPEIISLPTNLEAVE---------GKPFAANCTARGKPVPEISWIRDA 267
            :.:||:......:...|....::...:|:.:|         |:.....|.....|...|.|.:|.
 Worm    17 LSSGEMRAAVSNLVREIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVIYWEKDG 81

  Fly   268 ------TQLNVATADRFQVNP--QTGLVT----ISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVL 320
                  .:|||.......:.|  ::|::|    |...:....|:|.|:|.|....|:...|:   
 Worm    82 QRIQGDKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKCVATNGHDTVESSAKI--- 143

  Fly   321 VRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEP------ 379
                     :|.|...|     |::..|.||.||.   .|:..:.  .||:...:|...      
 Worm   144 ---------SVEGQTVK-----CKSTRRSAPVITM---STESRFE--LQDNAATLICRADRRANW 189

  Fly   380 ---------NFDEERGE--STGTLRISNAERSDDGLYQCIARNK 412
                     :||..|.|  .:|.|.|...:.||.|.|.|||.||
 Worm   190 NWMFEDKKIDFDSGRYELLPSGDLLIRKIQWSDMGSYFCIAHNK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 2/13 (15%)
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 22/109 (20%)
IGc2 243..309 CDD:197706 19/86 (22%)
IG_like 330..424 CDD:214653 29/100 (29%)
IGc2 339..412 CDD:197706 24/89 (27%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
zig-3NP_509336.1 I-set 45..145 CDD:254352 21/111 (19%)
Ig 61..142 CDD:143165 18/80 (23%)
IG_like 177..244 CDD:214653 17/57 (30%)
Ig <191..237 CDD:299845 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.