DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and zig-8

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:180 Identity:38/180 - (21%)
Similarity:70/180 - (38%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 CEVKADPNPTIDWLR--------NGDPIRTTNDKYVVQTNG-----LLIRNVQESDEGIYTCRAA 210
            |.|..|....|.|.|        .|:...|.:.::.|....     |.:|..::.|.|.|.|   
 Worm    57 CSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYLC--- 118

  Fly   211 VIETGELLER-----TIRVEVFIQPEIISLPTNLEA--------VEGKPFAANCTA----RGKPV 258
                 |:.::     .:.::| ::|.:.| |::|:.        :.|.....|||.    :.:.|
 Worm   119 -----EINDKHNTVYAVYLKV
-LEPPLPS-PSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEV 176

  Fly   259 PEISWIRDATQLNVATADRF--QVNPQTGLV----TISSVSQDDYGTYTC 302
            .::.|.||...:|....:::  :|....|:|    .|...:.:|.|.|.|
 Worm   177 LDVVWTRDGNTINFNDTEKYILKVKRDAGVVIETMRIRKATMEDDGNYAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 16/84 (19%)
IGc2 152..209 CDD:197706 15/62 (24%)
I-set 230..319 CDD:254352 21/91 (23%)
IGc2 243..309 CDD:197706 17/70 (24%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
zig-8NP_499714.1 IG_like 55..134 CDD:214653 16/84 (19%)
Ig 55..129 CDD:143165 16/79 (20%)
ig 158..229 CDD:278476 17/69 (25%)
IG_like 158..227 CDD:214653 17/69 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.