DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Il1r2

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001347729.1 Gene:Il1r2 / 16178 MGIID:96546 Length:428 Species:Mus musculus


Alignment Length:383 Identity:79/383 - (20%)
Similarity:135/383 - (35%) Gaps:126/383 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SCSLIELTR--------------------------AQSPILEIYP--------------KQEVQR 43
            ||:|.:|.|                          ::|||....|              |.|::.
Mouse     9 SCALRKLVRTMFILLVLVTGVSAFTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRL 73

  Fly    44 KPVGKPLILTCRPTVPEPSLVAD----LQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMIT 104
            :  |:|::|.| |..|...:.:.    |.|....::.::|    |::|.|:.     :...|.|.
Mouse    74 E--GEPVVLRC-PLAPHSDISSSSHSFLTWSKLDSSQLIP----RDEPRMWV-----KGNILWIL 126

  Fly   105 SLSVEMGGKYYCTASYANTEILEK-GVTIKTYVAITWTNAPENQY---PTLGQDYVVMCE----- 160
            ....:..|.|.||  :.|....|: .|.:|.: ..|..:.|...|   ..|....:::|.     
Mouse   127 PAVQQDSGTYICT--FRNASHCEQMSVELKVF-KNTEASLPHVSYLQISALSTTGLLVCPDLKEF 188

  Fly   161 VKADPNPTIDW--------------LRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAV 211
            :.::.:..|.|              |..|||.|            |||.|....|.|.|.|....
Mouse   189 ISSNADGKIQWYKGAILLDKGNKEFLSAGDPTR------------LLISNTSMDDAGYYRCVMTF 241

  Fly   212 IETGELLERTIRVEVFIQ-------PEIIS----LPTNLEA---VEGKPFAANCTARGKPVPEIS 262
            ...|:....|..:|:.::       |.|||    :|.:|.:   |..|.|....|:....|   .
Mouse   242 TYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLGSRLIVPCKVFLGTGTSSNTIV---W 303

  Fly   263 WIRDATQLNVA---------TADRFQVNPQTGLVTIS----SVSQDDYGT-YTCLAKN 306
            |:.::|.::.|         ...::..|.: ..|.:|    .|:::|..| :.|:|.|
Mouse   304 WLANSTFISAAYPRGRVTEGLHHQYSENDE-NYVEVSLIFDPVTREDLHTDFKCVASN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 22/98 (22%)
IG_like 144..226 CDD:214653 21/103 (20%)
IGc2 152..209 CDD:197706 16/75 (21%)
I-set 230..319 CDD:254352 23/98 (23%)
IGc2 243..309 CDD:197706 16/78 (21%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Il1r2NP_001347729.1 PHA02785 54..382 CDD:165149 70/338 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.