DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Bsg

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_033898.1 Gene:Bsg / 12215 MGIID:88208 Length:389 Species:Mus musculus


Alignment Length:421 Identity:93/421 - (22%)
Similarity:146/421 - (34%) Gaps:124/421 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKA 163
            |||..|.||    |:..|.|:                   .:..||.:|....|...|:.||...
Mouse     7 LALAFTLLS----GQGACAAA-------------------GFLKAPLSQERWAGGSVVLHCEAVG 48

  Fly   164 DPNPTIDWLRNGDPIRTTNDKYVVQTNG-------------------LLIRNVQESDEGIYTCRA 209
            .|.|.|.|...|:   ..||......:|                   |.:..:...|.|.|.|||
Mouse    49 SPIPEIQWWFEGN---APNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRA 110

  Fly   210 AVIETGELLERTIRVE--------VFIQPEIISLPTNLEAVEGK-PFAANCTARGKPVPEISWIR 265
            :.......|.|..||:        |.::|..|.  |:::.|..| ....:..:.|..:....|:|
Mouse   111 SSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQ--TSVQEVNSKTQLTCSLNSSGVDIVGHRWMR 173

  Fly   266 DATQLNVATADRFQVNPQTGLVTISSVSQDD-YGTYTCL-AKNRAGVVDQKTKLNVLVRPQIYEL 328
            ....|        |.:....|.|...|..|| .|.|:|: .....|    ::::||...|:|   
Mouse   174 GGKVL--------QEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVG----RSEINVEGPPRI--- 223

  Fly   329 YNVTGARTK-----EIA-ITCRAKGRPAPAITFRRW------GTQEEYTNGQQDDDPRIILEPNF 381
              ..|.:::     |:| :.|::.. ..|.||...|      |.:|..||..:.:...:::.   
Mouse   224 --KVGKKSEHSSEGELAKLVCKSDA-SYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVS--- 282

  Fly   382 DEERGESTGTLRISNAE-RSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPP------- 438
            ..|:.:    |.|||.: ..|.|.|.|.|.|......:|..:.|.     |.|..|.|       
Mouse   283 TPEKSQ----LTISNLDVNVDPGTYVCNATNAQGTTRETISLRVR-----SRMAALWPFLGIVAE 338

  Fly   439 -------VFSWEQRKANLSCLAMGIPNATIE 462
                   :|.:|:|:.         |:.|::
Mouse   339 VLVLVTIIFIYEKRRK---------PDQTLD 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 9/21 (43%)
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353 3/3 (100%)
Ig strand F 113..118 CDD:409353 1/4 (25%)
Ig 139..209 CDD:472250 20/88 (23%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 2/22 (9%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 19/92 (21%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 0/7 (0%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 2/4 (50%)
Ig strand F 298..306 CDD:409568 3/8 (38%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 24/106 (23%)
Ig strand B 339..343 CDD:409353 1/4 (25%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 1/5 (20%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 2/16 (13%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353
Ig strand F 501..506 CDD:409353
FN3 525..619 CDD:238020
FN3 640..735 CDD:238020
BsgNP_033898.1 Ig 23..138 CDD:472250 27/136 (20%)
Ig strand B 40..44 CDD:409534 1/3 (33%)
Ig strand C 53..57 CDD:409534 1/3 (33%)
Ig strand E 91..95 CDD:409534 1/3 (33%)
Ig strand F 105..110 CDD:409534 2/4 (50%)
Ig strand G 129..132 CDD:409534 0/2 (0%)
IG_like 233..322 CDD:214653 23/96 (24%)
Ig strand B 237..242 CDD:409436 1/4 (25%)
Ig strand C 251..259 CDD:409436 3/7 (43%)
Ig strand E 277..281 CDD:409436 0/3 (0%)
Ig strand F 302..307 CDD:409436 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..389 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.