DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Cntn5

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_446198.1 Gene:Cntn5 / 114589 RGDID:621302 Length:1099 Species:Rattus norvegicus


Alignment Length:831 Identity:182/831 - (21%)
Similarity:303/831 - (36%) Gaps:211/831 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMG 111
            |:.::|.|.|....|.::  ..|..|...:.:.:.:.|        .:..|:..|.|:.:.....
  Rat   210 GQGVVLMCSPPPHSPEII--YSWVFNEFPSFVAEDSRR--------FISQETGNLYISKVQTSDV 264

  Fly   112 GKYYCTASYA--NTEIL---------EKGV------TIKTYVAITWTNAPENQYPTLGQDYVVMC 159
            |.|.|....|  |..:|         ..||      .|:.:...|.|.|.       |....:.|
  Rat   265 GSYICLVKNAVTNARVLSPPTPL
TLRNDGVMGEYEPKIEVHFPTTVTAAK-------GTTVKMEC 322

  Fly   160 EVKADPNPTIDWLR-NG---DPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIE-----TG 215
            ....:|.|||.|:: ||   ...|....:.|::     |.|:|..|.|||.|.|....     .|
  Rat   323 FALGNPVPTITWMKVNGYIPSKSRLRKSQAVLE-----IPNLQLDDAGIYECTAENSRGKNSFRG 382

  Fly   216 ELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQV 280
            :|       :::..|..:....:.:...|.|....|.|.|||.|...|:::...|    ..:.:|
  Rat   383 QL-------QIYTYPHWVQKLNDTQLDSGSPLQWECKATGKPRPTYRWLKNGAPL----LPQSRV 436

  Fly   281 NPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGA----RTKEIAI 341
            :...|::.|.||:|.|.|.|.|||:|:.|.:....:|.:|..|..:||..|..:    :.:|:.|
  Rat   437 DTANGVLAIHSVNQSDAGMYQCLAENKYGAIYASAELKILASPPSFELNQVKKSIIVTKDREVLI 501

  Fly   342 TCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQ 406
            .|:.:|.|.|||:   |...::...|.:    ||.:.|:         |:|||.||.::|:|.|.
  Rat   502 ECKPQGSPKPAIS---WRKGDKAVRGNK----RIAILPD---------GSLRILNASKADEGKYI 550

  Fly   407 CIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKAN--------LSCLAMGIPNATIEW 463
            |    :|.:.:.:..|....:.......||.|      ::..        |:|.||...:..:.:
  Rat   551 C----QGVNIFGSAEIIASVSVKEPTRIELTP------KRTELTVGESIVLNCKAMHDSSLDVTF 605

  Fly   464 HW--NGRKIKDLYDTNLK------IVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLK 520
            :|  .|:.|    |...:      |......:||::..:...:...|.|.......:...:.:|.
  Rat   606 YWTLKGQPI----DFEKEGGHFESIRAQASSADLMIRNILLMHAGRYGCRVQTTADSVSDEAELL 666

  Fly   521 EARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDSPY 585
            ....|.........::|.:|.|.. ..|:|:...||.:|::|.:...:..|.|.      ...|.
  Rat   667 VRGPPGPPGVVIVEEITESTATLS-WSPATDNHSPISSYNLQARSPFSLGWQTV------KTVPE 724

  Fly   586 IVEG---------LRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEP------------- 628
            ::.|         |.|..||.||..|.|.:|.|:..:..:......:.|:..             
  Rat   725 VITGDMESAMAVDLNPWVEYEFRVVATNPIGTGDPSIPSRMIRTNEAVPKTAPSNVSGGSGRRHE 789

  Fly   629 -----KPLHNPVQHD-----------------KEEPVVVSP-----YSDH-------FELRWGVP 659
                 :|:....|:.                 ||:.|..|.     |.|.       ||::.||.
  Rat   790 LVIAWEPVSEEFQNGEGFGYIVAFRPNGTRGWKEKMVTSSDASKFIYRDESVPPLTPFEVKVGVY 854

  Fly   660 ADNGEPIDRYQIKYC---------------PGVKIS---------------------GTW--TEL 686
            .:.|:......:..|               ..|.:|                     |.|  ||.
  Rat   855 NNKGDGPFSQIVVICSAEGEPTAAPTDVTATSVSVSEIFVVWKHVKESLGRPQGFEIGYWKDTEP 919

  Fly   687 ENSCNTVEVMETTSFEM-TQLVGNTYYRIELKAHNAIGYSSPASIIMKTTR 736
            |:|..||......||.| |.|.|:|.|.:.::|:|..||..|:..:..||:
  Rat   920 EDSAETVRTRGNESFVMLTGLEGDTLYHLTVRAYNGAGYGPPSREVSATTK 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 14/73 (19%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 22/73 (30%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 2/3 (67%)
Ig strand E 190..194 CDD:409353 0/3 (0%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 26/89 (29%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 26/97 (27%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 13/83 (16%)
Ig strand B 447..451 CDD:409353 1/11 (9%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 24/102 (24%)
FN3 640..735 CDD:238020 34/145 (23%)
Cntn5NP_446198.1 Ig 98..193 CDD:472250
Ig strand B 119..123 CDD:409353
Ig strand C 132..136 CDD:409353
Ig strand E 155..159 CDD:409353
Ig strand F 170..175 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 202..287 CDD:472250 17/86 (20%)
Ig strand B 213..217 CDD:409353 1/3 (33%)
Ig strand C 227..231 CDD:409353 0/5 (0%)
Ig strand E 252..256 CDD:409353 1/3 (33%)
Ig strand F 266..271 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Ig 300..387 CDD:472250 26/105 (25%)
Ig strand B 318..322 CDD:409353 0/3 (0%)
Ig strand C 331..335 CDD:409353 2/3 (67%)
Ig strand E 352..356 CDD:409353 1/8 (13%)
Ig strand F 366..371 CDD:409353 3/4 (75%)
Ig strand G 379..382 CDD:409353 0/2 (0%)
Ig 392..475 CDD:472250 25/86 (29%)
Ig strand B 407..411 CDD:143205 0/3 (0%)
Ig strand C 420..424 CDD:143205 0/3 (0%)
Ig strand E 441..445 CDD:143205 1/3 (33%)
Ig strand F 455..460 CDD:143205 2/4 (50%)
Ig strand G 468..471 CDD:143205 0/2 (0%)
Ig5_Contactin 480..568 CDD:409358 28/107 (26%)
Ig strand A 480..485 CDD:409358 1/4 (25%)
Ig strand A' 488..493 CDD:409358 0/4 (0%)
Ig strand B 497..504 CDD:409358 2/6 (33%)
Ig strand C 512..516 CDD:409358 2/6 (33%)
Ig strand D 530..533 CDD:409358 0/2 (0%)
Ig strand E 534..539 CDD:409358 3/4 (75%)
Ig strand F 547..555 CDD:409358 4/11 (36%)
Ig strand G 561..568 CDD:409358 1/6 (17%)
Ig 570..671 CDD:472250 17/110 (15%)
Ig strand B 589..593 CDD:409353 1/3 (33%)
Ig strand C 604..608 CDD:409353 0/3 (0%)
Ig strand E 633..637 CDD:409353 2/3 (67%)
Ig strand F 647..652 CDD:409353 2/4 (50%)
Ig strand G 660..663 CDD:409353 0/2 (0%)
FN3 667..>1060 CDD:442628 64/311 (21%)
FN3 671..768 CDD:238020 24/103 (23%)
FN3 878..969 CDD:238020 23/90 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 958..983 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.