DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Il1rl2

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001343407.1 Gene:Il1rl2 / 107527 MGIID:1913107 Length:574 Species:Mus musculus


Alignment Length:365 Identity:79/365 - (21%)
Similarity:128/365 - (35%) Gaps:92/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GVFLALLLC----SCSLIELTRAQSPILEIYPKQEVQRKPVGKPLILTCR-PTVPEPSLVADLQW 69
            |||..|||.    :|.            :|:....:..:  |:|....|. |  ||.:...:|.|
Mouse    10 GVFFLLLLFVAADTCE------------DIFMHNVIISE--GQPFPFNCTYP--PETNGAVNLTW 58

  Fly    70 KDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANT--EILEKGVTI 132
            ....:.:  |..|.|:......:|.      ::...|::|..|.|.|....|:.  :|......:
Mouse    59 YKTPSKS--PVSNNRHLRVHQDQTW------ILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVL 115

  Fly   133 KTYVAITW---------TNAPE--NQYPTLGQDYVVMCEVKADPNPTID---WLRNGDPIRTTND 183
            |.:    |         .|:|:  .|...:|:...:.|.:....:..:|   |.:..:.|: ...
Mouse   116 KNH----WCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIK-AGK 175

  Fly   184 KYVVQTNGLLIRNVQESDEGIYTCRAAVIETGE-------LLERTIRVEVFIQPEIISLPTN--L 239
            ||......||:.||...|.|.|.|.|.:...|.       :...|..||...:...|:.|.|  :
Mouse   176 KYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSI 240

  Fly   240 EAVEGKPFAANC--TARGKPVPEISW----------------IRDATQLNVATAD--RFQVNPQT 284
            |...|.....||  |...:......|                |::..:.||:..|  |:.||   
Mouse   241 EVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVN--- 302

  Fly   285 GLVTISSVSQDDYG-TYTCLAKNRAGVVDQKTKLNVLVRP 323
              :|...|..:||| .:||.|...|..:       :|:.|
Mouse   303 --ITFLKVKMEDYGRPFTCHAGVSAAYI-------ILIYP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 19/96 (20%)
IG_like 144..226 CDD:214653 21/93 (23%)
IGc2 152..209 CDD:197706 15/59 (25%)
I-set 230..319 CDD:254352 25/111 (23%)
IGc2 243..309 CDD:197706 20/86 (23%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Il1rl2NP_001343407.1 Ig 25..115 CDD:416386 20/113 (18%)
Ig strand A' 31..35 CDD:409353 0/3 (0%)
Ig strand B 39..44 CDD:409353 1/4 (25%)
Ig strand C 55..59 CDD:409353 1/3 (33%)
Ig strand C' 64..66 CDD:409353 0/3 (0%)
Ig strand D 74..78 CDD:409353 0/3 (0%)
Ig strand E 80..84 CDD:409353 1/9 (11%)
Ig strand F 93..101 CDD:409353 3/7 (43%)
Ig strand G 104..115 CDD:409353 1/10 (10%)
Ig 135..222 CDD:416386 19/87 (22%)
Ig strand A 135..140 CDD:409353 1/4 (25%)
Ig strand B 145..149 CDD:409353 0/3 (0%)
Ig strand C 161..166 CDD:409353 1/4 (25%)
Ig strand C' 169..171 CDD:409353 0/1 (0%)
Ig strand D 176..180 CDD:409353 2/3 (67%)
Ig strand E 182..187 CDD:409353 2/4 (50%)
Ig strand F 196..205 CDD:409353 3/8 (38%)
Ig strand G 208..221 CDD:409353 0/12 (0%)
Ig 230..332 CDD:416386 26/113 (23%)
Ig strand A 230..233 CDD:409353 0/2 (0%)
Ig strand A' 238..241 CDD:409353 0/2 (0%)
Ig strand B 246..255 CDD:409353 2/8 (25%)
Ig strand C 262..268 CDD:409353 1/5 (20%)
Ig strand C' 270..273 CDD:409353 0/2 (0%)
Ig strand G 322..332 CDD:409353 2/16 (13%)
TIR 389..539 CDD:396246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.