DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and mxra5

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_002941051.4 Gene:mxra5 / 100495231 XenbaseID:XB-GENE-923372 Length:2851 Species:Xenopus tropicalis


Alignment Length:780 Identity:184/780 - (23%)
Similarity:302/780 - (38%) Gaps:186/780 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KPLILTC--RPTVPEPSLVADLQWKDNRNNT----------------------ILP--KPNGRNQ 86
            ||:|.|.  :|.:| .:||.|   ..|:.||                      ::|  ||..:.|
 Frog  1757 KPIIFTATLKPPIP-TNLVPD---SANKKNTYVSAAKTTISSAIIKATVAPLPVIPVTKPATQKQ 1817

  Fly    87 PPM------YTETLPGESLALMITSLSVEMGGKYYCT--ASYANTEILEKGVT-----IKTYVAI 138
            ..:      :|:| |..|..:.:......:..|....  |...|...::..||     ||..:..
 Frog  1818 MQLTTPYIVHTQT-PKSSSTIQLNRYFNHINNKPSIVEGAKLTNLNEIQSSVTQRPQGIKPRITT 1881

  Fly   139 TWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLR--NGDPI--RTTNDKYVVQTNGLL-IRNVQ 198
            |...:....:.|   |.|:.||...||.|:|.|.:  .|..:  .|...:|.|..||.| |:.:|
 Frog  1882 TGLQSLSVPFET---DAVIPCETFGDPKPSITWTKVATGAVMSKNTRMQRYEVLENGTLSIQKLQ 1943

  Fly   199 ESDEGIYTCRAAVIETGELLERTIRVEVFIQPEII-SLPTNLEAVEGKPFAANCTARGKPVPEIS 262
            ..|.|.|.|.|......:.:..|:.| |..||.|: |...::....|...:.:|.|.|.|...||
 Frog  1944 LQDHGQYVCTAQNQHGIDKMYVTLTV-VVQQPRILGSRYKDVTVYIGDTISMDCPASGVPSVHIS 2007

  Fly   263 WI---RDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQ 324
            ||   |...:...||..|..:: :.|.:.|...:..|.|.:.|:|.|.||......:|::...|.
 Frog  2008 WIFPDRKIIRTVSATESRIMLH-ENGTLIIKETTFTDRGIFKCVASNVAGADSLTVRLHIAALPP 2071

  Fly   325 IY---ELYNVTGARTKEIAITCRAKGRPAPAITFRRW----GTQ---EEYTNGQQDDDPRIILEP 379
            |.   :..|:|......:.|.|.|||.|:|:|   ||    |||   .::.||      .:.:.|
 Frog  2072 IIKQEKQENITLPHGHSVYIHCSAKGAPSPSI---RWVLFDGTQVRTSQFVNG------NVFVFP 2127

  Fly   380 NFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQ 444
            |         |||.|.:..:.|.|.|:|:|.|....|.:|..:.|:.....:.:....|      
 Frog  2128 N---------GTLYIRSLSQKDTGKYECVATNIVGAARRTIMLDVKKLASNAKITASSP------ 2177

  Fly   445 RKAN--------LSCLAMGIPNATIEWHWNGRKIKD---LYDTNLKIVGTGPRSDLIVHPVTRQY 498
            :|.:        |.|.|.|.|...|.|....:::.|   .:|:.:|....|   .|:::.||.:.
 Frog  2178 QKTDVTYGSTLRLDCSAAGDPWPRILWRLPSKRVVDSFFSFDSRIKTYSNG---TLLIYSVTEKD 2239

  Fly   499 YSGYKCIATNIHG----TAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAY 559
            ...|.|:|.|..|    ..:.::.:|.|:: .:.:|.....:....:..|.  .:|.:..|.:::
 Frog  2240 AGDYLCMARNKLGDDYVVLKVNVMMKPAKI-QYKNEVDHKVMYGGDLKVDC--IATGVPNPEISW 2301

  Fly   560 SVQYKEALNPDWSTAYNRSWSPDS-----PYIV----------EGLRPQTEYSFRFAARNQVGLG 609
            |:       ||.|...|...|.||     .|:|          .||:.:.:|:  ..|.||:|..
 Frog  2302 SL-------PDGSMINNIMQSDDSGTRTRRYVVFNNGTLYFNEVGLKEEGDYT--CYAINQIGQD 2357

  Fly   610 NWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSPYSDHF------------ELRWGVPADN 662
            ...|:.:....:            .|..:|...::..||.|..            ::.|..|::.
 Frog  2358 EMRVSVKVVAEK------------AVIKNKTHSIIHVPYGDVVTVSCEAKGEPVPKIIWLSPSNR 2410

  Fly   663 GEP--IDRYQIKYCPGVKI--------SGTWTELENSCNTVEVMETTSFEMTQLVGNTYYRIELK 717
            ..|  .|:||| |..|..:        ||.:|     |    :.:.|..|..::|     :|::|
 Frog  2411 PIPSLSDKYQI-YRDGSLLIQKAQRSDSGNYT-----C----IAQNTGGEDKKIV-----QIQVK 2460

  Fly   718  717
             Frog  2461  2460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 22/106 (21%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 1/6 (17%)
Ig 139..209 CDD:472250 24/74 (32%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 27/93 (29%)
Ig strand A 229..232 CDD:409568 2/2 (100%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 2/3 (67%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 3/7 (43%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 31/100 (31%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 19/82 (23%)
Ig strand B 447..451 CDD:409353 1/11 (9%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 22/108 (20%)
FN3 640..735 CDD:238020 21/100 (21%)
mxra5XP_002941051.4 LRRNT 44..75 CDD:214470
leucine-rich repeat 55..72 CDD:275380
LRR <72..>245 CDD:443914
leucine-rich repeat 74..97 CDD:275380
leucine-rich repeat 98..121 CDD:275380
leucine-rich repeat 122..145 CDD:275380
leucine-rich repeat 146..169 CDD:275380
leucine-rich repeat 170..201 CDD:275380
leucine-rich repeat 202..225 CDD:275380
LRRCT 234..293 CDD:214507
Ig strand B 510..513 CDD:409353
IG_like 511..584 CDD:214653
Ig strand C 522..526 CDD:409353
Ig strand E 550..554 CDD:409353
Ig strand F 564..569 CDD:409353
IG_like 598..680 CDD:214653
Ig strand B 607..611 CDD:409421
Ig strand C 620..624 CDD:409421
Ig strand E 646..650 CDD:409421
Ig strand F 660..665 CDD:409421
Ig strand G 673..676 CDD:409421
Herpes_BLLF1 <1269..1567 CDD:282904
Ig 1895..1959 CDD:409353 22/63 (35%)
Ig strand B 1895..1899 CDD:409353 1/3 (33%)
Ig strand C 1908..1912 CDD:409353 1/3 (33%)
Ig strand E 1935..1939 CDD:409353 2/3 (67%)
Ig strand F 1949..1954 CDD:409353 2/4 (50%)
Ig 1989..2066 CDD:472250 23/77 (30%)
Ig strand B 1992..1996 CDD:409421 0/3 (0%)
Ig strand C 2005..2009 CDD:409421 2/3 (67%)
Ig strand E 2032..2036 CDD:409421 1/3 (33%)
Ig strand F 2046..2051 CDD:409421 1/4 (25%)
Ig strand G 2059..2062 CDD:409421 0/2 (0%)
Ig 2072..2163 CDD:472250 32/108 (30%)
Ig strand B 2089..2093 CDD:409544 1/3 (33%)
Ig strand C 2102..2107 CDD:409544 3/7 (43%)
Ig strand E 2129..2133 CDD:409544 3/3 (100%)
Ig strand F 2143..2148 CDD:409544 2/4 (50%)
Ig strand G 2156..2159 CDD:409544 0/2 (0%)
Ig 2172..2252 CDD:472250 20/88 (23%)
Ig strand B 2188..2192 CDD:409544 1/3 (33%)
Ig strand C 2201..2205 CDD:409544 1/3 (33%)
Ig strand E 2228..2232 CDD:409544 2/6 (33%)
Ig strand F 2242..2247 CDD:409544 2/4 (50%)
Ig 2279..2365 CDD:472250 21/96 (22%)
Ig strand B 2285..2289 CDD:409421 0/3 (0%)
Ig strand C 2298..2302 CDD:409421 0/3 (0%)
Ig strand E 2331..2335 CDD:409421 0/3 (0%)
Ig strand F 2345..2350 CDD:409421 1/6 (17%)
Ig strand G 2358..2361 CDD:409421 0/2 (0%)
I-set 2382..2459 CDD:400151 20/91 (22%)
Ig strand B 2388..2392 CDD:409561 0/3 (0%)
Ig strand C 2401..2405 CDD:409561 0/3 (0%)
Ig strand E 2425..2429 CDD:409561 1/3 (33%)
Ig strand F 2439..2444 CDD:409561 2/13 (15%)
Ig strand G 2452..2455 CDD:409561 0/2 (0%)
Ig 2475..2559 CDD:472250
Ig strand B 2486..2490 CDD:409421
Ig strand C 2499..2503 CDD:409421
Ig strand E 2525..2529 CDD:409421
Ig strand F 2539..2544 CDD:409421
Ig strand G 2552..2555 CDD:409421
Ig_3 2565..2643 CDD:464046
IG_like 2675..2751 CDD:214653
Ig strand B 2678..2682 CDD:409353
Ig strand C 2691..2695 CDD:409353
Ig strand E 2717..2721 CDD:409353
Ig strand F 2731..2736 CDD:409353
Ig_3 2755..2837 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.