DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and igsf10

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_012819117.2 Gene:igsf10 / 100494018 XenbaseID:XB-GENE-6072998 Length:2884 Species:Xenopus tropicalis


Alignment Length:622 Identity:151/622 - (24%)
Similarity:243/622 - (39%) Gaps:114/622 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIELTRAQSPILEIYPKQEVQRKPVGKPLILTCRPT-VPEPSLVADLQWK------DNRNNTILP 79
            ::|.:.....|.:..||  ......|..|:|.|..| .|:|.::..|..|      ....:.|..
 Frog  2190 IVEQSDTFPKITDASPK--ATEMNFGDKLMLNCTATGEPKPRIIWRLPSKAVVDQLHRMGSRIQV 2252

  Fly    80 KPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTA--SYANTEILEK-GVTIKTYVAITWT 141
            .|||                .|.:.|::.:..|.|.|.|  ...:..||.| .||:|....|  .
 Frog  2253 FPNG----------------TLFVDSVNDKDAGDYLCVARNKMGDDVILMKVSVTMKPAKII--Q 2299

  Fly   142 NAPENQYPTLGQDYVVMCEVKADPNPTIDW-LRNGDPIRT---TND------KYVVQTNGLLIRN 196
            ..|..:....|:|:.|.|:....|.|.|.| |.:|..|..   .:|      :|::..||.|..|
 Frog  2300 KQPLAKQVPYGKDFKVDCKASGSPLPDISWSLPDGTMINNILQADDSGRRKRRYILFDNGTLYLN 2364

  Fly   197 -VQESDEGIYTCRAAVIETGELLERTIRVEVFI---QPEI-ISLPTNLEAVEGKPFAANCTARGK 256
             |..::||.|||.|    ..:|....::|.:.:   .|.| :::.|...|:.|:....:|.|.|:
 Frog  2365 KVGIAEEGDYTCYA----ENQLGRDEMKVHITVVTAAPLIKLNMKTRYAAMAGESVILDCEANGE 2425

  Fly   257 PVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV 321
            |.|:|.|:..::.:...:.||:.:: :.|.:|:|.|...|.|.|.|:|:|.||...:..:|.|..
 Frog  2426 PKPKIFWLLPSSDMIAISHDRYLLH-ENGSLTVSQVKLLDAGEYMCVARNPAGDDTKLLRLEVHP 2489

  Fly   322 RPQIYE-LYN------VTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEP 379
            :|.|.. ||:      .|..:.....|.|:|:| .||....  |...:...........||::..
 Frog  2490 KPPIINGLYSNKSIIKDTAIKHSRKLIDCKAEG-AAPLQVM--WIMPDNIYLTAPYHGSRILVHQ 2551

  Fly   380 NFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITV-------EFAPDFSHMKELP 437
            |         |||.|.|...||...:.|:|||.|.::.....:.|       .|...|:.     
 Frog  2552 N---------GTLEIRNIRPSDTAEFTCVARNDGGESMLVVQLEVLEMLRRPMFKNPFNE----- 2602

  Fly   438 PVFSWEQRKANLSCLAMGIPNATIEWHW-NGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSG 501
            ...:...:.|.|:|.|.|.|...|.|.. ||.:.  |...::.....|.....|::..|:.....
 Frog  2603 KFIAKSSKMAILNCFAEGNPTPEIIWLLPNGTRF--LNGPSISKYHAGSNGTFIIYSPTKDDAGK 2665

  Fly   502 YKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEA 566
            |:|.|.|..|..|..:.|:..:.|:.::..              |||...:          ..||
 Frog  2666 YRCAARNKVGYIEKLIILEVGQKPNILTHP--------------RGPIKSI----------IGEA 2706

  Fly   567 LN----PDWSTAYNRSWSPDSPYIVEGLRPQTEYSFR 599
            |:    .|.....:.:|...|.|.:|  |||.:..::
 Frog  2707 LSLHCLSDGMPRPSVTWILPSGYAIE--RPQVQGRYK 2741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 21/96 (22%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 24/80 (30%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 2/4 (50%)
Ig strand E 190..194 CDD:409353 2/3 (67%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 27/90 (30%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 1/3 (33%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 2/4 (50%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 23/99 (23%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 1/4 (25%)
Ig 447..515 CDD:409353 19/68 (28%)
Ig strand B 447..451 CDD:409353 2/3 (67%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 0/3 (0%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 15/79 (19%)
FN3 640..735 CDD:238020
igsf10XP_012819117.2 leucine-rich repeat 40..59 CDD:275380
LRR <59..>220 CDD:443914
leucine-rich repeat 60..83 CDD:275380
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..187 CDD:275380
leucine-rich repeat 188..211 CDD:275380
PCC 193..>277 CDD:188093
Ig 477..552 CDD:472250
Ig strand B 490..494 CDD:409353
Ig strand C 503..508 CDD:409353
Ig strand E 531..535 CDD:409353
Ig strand F 545..550 CDD:409353
Ig <590..649 CDD:472250
Ig strand C 601..605 CDD:409353
Ig strand E 625..629 CDD:409353
Ig strand F 639..644 CDD:409353
Herpes_BLLF1 <885..1272 CDD:282904
Ig_3 1904..1984 CDD:464046
Ig 2004..2094 CDD:472250
Ig strand B 2020..2024 CDD:409353
Ig strand C 2033..2037 CDD:409353
Ig strand E 2060..2064 CDD:409353
Ig strand F 2074..2079 CDD:409353
Ig strand G 2087..2090 CDD:409353
Ig_3 2098..2177 CDD:464046
Ig_3 2198..2277 CDD:464046 22/96 (23%)
Ig 2300..2383 CDD:472250 25/86 (29%)
Ig strand C 2326..2330 CDD:409353 1/3 (33%)
Ig strand E 2359..2363 CDD:409353 2/3 (67%)
Ig strand F 2373..2378 CDD:409353 3/4 (75%)
IG_like 2410..2487 CDD:214653 24/77 (31%)
Ig strand B 2416..2420 CDD:409353 0/3 (0%)
Ig strand C 2429..2433 CDD:409353 1/3 (33%)
Ig strand E 2453..2457 CDD:409353 1/3 (33%)
Ig strand F 2467..2472 CDD:409353 2/4 (50%)
Ig strand B 2515..2518 CDD:409353 1/2 (50%)
IG_like 2516..2587 CDD:214653 22/82 (27%)
Ig strand C 2527..2531 CDD:409353 0/5 (0%)
Ig strand E 2553..2557 CDD:409353 3/3 (100%)
Ig strand F 2567..2572 CDD:409353 1/4 (25%)
Ig strand G 2580..2583 CDD:409353 0/2 (0%)
Ig_3 2605..2672 CDD:464046 17/68 (25%)
Ig_3 2688..2767 CDD:464046 15/80 (19%)
Ig_3 2784..2866 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.