| Sequence 1: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751462.1 | Gene: | lsamp / 100124984 | XenbaseID: | XB-GENE-5759171 | Length: | 368 | Species: | Xenopus tropicalis |
| Alignment Length: | 332 | Identity: | 82/332 - (24%) |
|---|---|---|---|
| Similarity: | 133/332 - (40%) | Gaps: | 44/332 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 238 NLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGL---------VTISSVS 293
Fly 294 QDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYEL-YNVTGARTKEIAITCRAKGRPAPAITFRR 357
Fly 358 WGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADA-YKTGH 421
Fly 422 ITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDT-NLKIVGTGP 485
Fly 486 RSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIR---- 546
Fly 547 -GPSTEL 552 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | |
| IG_like | 144..226 | CDD:214653 | |||
| IGc2 | 152..209 | CDD:197706 | |||
| I-set | 230..319 | CDD:254352 | 16/89 (18%) | ||
| IGc2 | 243..309 | CDD:197706 | 14/74 (19%) | ||
| IG_like | 330..424 | CDD:214653 | 26/94 (28%) | ||
| IGc2 | 339..412 | CDD:197706 | 21/72 (29%) | ||
| Ig | 447..518 | CDD:143165 | 23/71 (32%) | ||
| fn3 | 534..611 | CDD:278470 | 4/24 (17%) | ||
| FN3 | 640..735 | CDD:238020 | |||
| lsamp | XP_031751462.1 | Ig | 38..128 | CDD:416386 | 16/89 (18%) |
| FR1 | 38..54 | CDD:409353 | 2/13 (15%) | ||
| Ig strand A' | 39..45 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 47..55 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 55..59 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 60..67 | CDD:409353 | 1/7 (14%) | ||
| Ig strand C | 60..66 | CDD:409353 | 1/6 (17%) | ||
| CDR2 | 68..78 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C' | 70..73 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 75..78 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 79..114 | CDD:409353 | 9/34 (26%) | ||
| Ig strand D | 83..90 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 93..99 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 106..114 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 115..119 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 119..128 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 121..128 | CDD:409353 | 1/6 (17%) | ||
| Ig_3 | 131..206 | CDD:404760 | 24/89 (27%) | ||
| Ig strand A' | 138..143 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 149..156 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 162..167 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 173..175 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 185..191 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 198..205 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 212..220 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 223..302 | CDD:404760 | 23/81 (28%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 240..244 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 253..257 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 281..285 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 295..300 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 308..311 | CDD:409353 | 0/2 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I10621 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||