DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and l1cam

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_012823307.1 Gene:l1cam / 100124734 XenbaseID:XB-GENE-5914700 Length:1254 Species:Xenopus tropicalis


Alignment Length:890 Identity:199/890 - (22%)
Similarity:319/890 - (35%) Gaps:257/890 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PNSVGVFLALLLCSCSLIELTRAQSPILEIYPKQEVQRKPV-------------GKPLILTCRPT 57
            |..:|..|..||||    .:...|.|  :.|..||:...||             ...::|.|.  
 Frog     7 PCLLGTVLVSLLCS----HMEAFQLP--KGYVMQEIMYPPVITEQSPEKYVLYPNDDIVLKCE-- 63

  Fly    58 VPEPSLVADLQWK--------DNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKY 114
             .:.:..|...||        ||.......|.:|       |..:.|...::.      :..|||
 Frog    64 -AKRNAKAKYTWKKDGETFQPDNDPRVSRKKDSG-------TLNISGNGNSMK------DFQGKY 114

  Fly   115 YCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTL-------GQDYVVMCE-VKADPNPTIDW 171
            .|   ||..::   |..|...:.:...:.|:.|...:       |...::.|. .|:...|.:.|
 Frog   115 RC---YATNDL---GTAISHEIHVITESTPKWQKELIRPLDIEEGASLILPCNPPKSAVPPRVIW 173

  Fly   172 LRNGDPIRTTNDKYV-VQTNG-LLIRNVQESDE-GIYTCRAAVIETGELLER-TIRVEV------ 226
            : |.:.:..|.|:.| :..|| |...|||:.|| ..|.|.|..:....:::: .|.::|      
 Frog   174 M-NSNLLHITQDERVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTIVQKEAISIKVRPTNSV 237

  Fly   227 -FIQPEII----SLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGL 286
             |.:||::    |:.|.| |:..:|....|.|.|.|.|||.||   ..|.....:|.|.:.....
 Frog   238 KFRKPEMMLPEGSMSTVL-ALRDQPLQLECIAEGLPTPEIEWI---PLLGSTYNERIQFDDFKKT 298

  Fly   287 VTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV--------RPQ--IYELYNVTGARTKEIAI 341
            :.|..|..:|.|.|.|:|||..|  .......|:|        :|:  ||       |..::|.:
 Frog   299 LHIDKVQDEDDGDYQCIAKNTQG--SSSHTFTVVVESAPYWINKPEDGIY-------APGEDIIL 354

  Fly   342 TCRAKGRPAPAITFRRWGTQEE---------------YTNGQQDDD------------------- 372
            .|...|:|.|.:|::..|...:               ..|..|.:|                   
 Frog   355 HCEVGGKPKPKVTWKINGKSLKDSDLYHNWKLIDGSLVLNNMQLNDTSVVQCEARNKHGNLLANA 419

  Fly   373 --------PRII----------------------------------LEPN---FDEERGESTGTL 392
                    |:|:                                  ||.|   .|:....:.|||
 Frog   420 FVYVVELPPQILTRNDEQYIVVEKTNVSMDCRAFGTPFPTIQWESDLEDNLFALDQFSMHTNGTL 484

  Fly   393 RISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKEL--PPVFSWEQR-----KANLS 450
            .|:...:.|:|:|:|.|.|      ..|::::....|..:..::  ||:   ||.     ||...
 Frog   485 TITGVAKEDEGIYRCTASN------NQGNVSISAYLDVRNATKIITPPM---EQHARKGGKAIFQ 540

  Fly   451 CLAMGIPNAT---IEWHWNGRKIKDLYDTNLKIVGTGPRSD--LIVHPVTRQYYSGYKCIATNIH 510
            |.....|..:   |:|..||.:||:..|.:...:     .|  |.:..|....:..|.|.|....
 Frog   541 CKVEFDPKMSDKIIQWRKNGNEIKEDADNDKYFI-----EDYTLSISNVQESDHGMYTCAAHTEL 600

  Fly   511 GTAEHDMQLKEARVPD--FVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKE-ALNPD-W 571
            ...|...:|....:|:  |..|...:|.|:.|:|:.   |..:...||..:.::|:| :..|. |
 Frog   601 DAVELTAELVVIDLPEAPFDLELSNAQETSITLTWT---PGNDNNSPIEEFIIEYEEDSFEPGVW 662

  Fly   572 STAYNRSWSPDSPYIVEG--------LRPQTEYSFRFAARNQVGLGNWGVN--QQQSTPRRSAPE 626
            .....          |:|        |.|...|.||..|.|:||..| |.|  .:..||..:..:
 Frog   663 HELTR----------VDGDMFNVDLDLSPYVNYQFRVIAVNEVGPSN-GSNPSDRYETPAFAPAK 716

  Fly   627 EPKPLHNPVQHDKEEPVVVSPYSDHFELRW----GVPADNGEPIDRYQIKYCPGVKISGTWTELE 687
            .|:    .|:.:..||       .:..:.|    |:  |...|..:|.:|:....|  ..|.|:.
 Frog   717 NPR----EVKGEGTEP-------QNMYISWKPLKGI--DWNGPGFKYLVKWRQLGK--EEWKEVV 766

  Fly   688 NSCNTVEVMETTSFEMTQLVGNTYYRIELKAHNAIGYSS-PASII 731
            .....|.|..|:.||.        |.|.:::.|.||.:: |..:|
 Frog   767 ADSPPVLVSGTSIFEP--------YEIIVQSVNDIGRATEPKPVI 803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 20/108 (19%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 3/4 (75%)
Ig 139..209 CDD:472250 21/80 (26%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 29/93 (31%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 1/2 (50%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 2/3 (67%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 2/3 (67%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 28/172 (16%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 16/72 (22%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 1/6 (17%)
Ig strand E 487..491 CDD:409353 2/5 (40%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 28/107 (26%)
FN3 640..735 CDD:238020 23/97 (24%)
l1camXP_012823307.1 Ig 40..133 CDD:472250 21/114 (18%)
Ig strand B 58..62 CDD:409353 1/3 (33%)
Ig strand C 71..75 CDD:409353 0/3 (0%)
Ig strand E 96..100 CDD:409353 2/10 (20%)
Ig strand F 113..118 CDD:409353 3/7 (43%)
Ig strand G 127..130 CDD:409353 0/2 (0%)
IgI_2_L1-CAM_like 142..232 CDD:409432 21/90 (23%)
Ig strand A 142..145 CDD:409432 0/2 (0%)
Ig strand A' 147..151 CDD:409432 0/3 (0%)
Ig strand B 154..162 CDD:409432 1/7 (14%)
Ig strand C 169..175 CDD:409432 2/6 (33%)
Ig strand C' 178..181 CDD:409432 0/2 (0%)
Ig strand D 187..191 CDD:409432 1/3 (33%)
Ig strand E 193..197 CDD:409432 2/3 (67%)
Ig strand F 208..216 CDD:409432 3/7 (43%)
Ig strand G 219..232 CDD:409432 1/12 (8%)
Ig3_L1-CAM_like 250..332 CDD:409394 28/87 (32%)
Ig strand B 262..266 CDD:409394 0/3 (0%)
Ig strand C 275..279 CDD:409394 2/3 (67%)
Ig strand E 297..301 CDD:409394 0/3 (0%)
Ig strand F 311..316 CDD:409394 2/4 (50%)
Ig strand G 324..327 CDD:409394 0/2 (0%)
Ig 336..424 CDD:472250 14/94 (15%)
Ig strand B 352..356 CDD:409353 1/3 (33%)
Ig strand C 365..369 CDD:409353 1/3 (33%)
Ig strand E 389..393 CDD:409353 0/3 (0%)
Ig strand F 403..408 CDD:409353 0/4 (0%)
Ig strand G 416..419 CDD:409353 0/2 (0%)
Ig 430..516 CDD:472250 16/91 (18%)
Ig strand B 446..450 CDD:409353 0/3 (0%)
Ig strand C 459..463 CDD:409353 0/3 (0%)
Ig strand E 482..486 CDD:409353 3/3 (100%)
Ig strand F 496..501 CDD:409353 2/4 (50%)
Ig strand G 509..512 CDD:409353 0/2 (0%)
Ig 521..611 CDD:472250 23/97 (24%)
Ig strand B 537..541 CDD:409353 1/3 (33%)
Ig strand C 550..557 CDD:409353 1/6 (17%)
Ig strand E 577..581 CDD:409353 1/3 (33%)
Ig strand F 591..596 CDD:409353 2/4 (50%)
Ig strand G 604..607 CDD:409353 1/2 (50%)
FN3 615..704 CDD:238020 28/102 (27%)
FN3 717..795 CDD:238020 22/100 (22%)
FN3 815..907 CDD:238020
FN3 <877..>1119 CDD:442628
Bravo_FIGEY 1141..1230 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.