DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and kazald1

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001093733.1 Gene:kazald1 / 100101767 XenbaseID:XB-GENE-486704 Length:299 Species:Xenopus tropicalis


Alignment Length:167 Identity:50/167 - (29%)
Similarity:77/167 - (46%) Gaps:21/167 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 PQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV--------RPQI----YELYNVTGA 334
            ||...|..::|...|..||:.|.|.:. |.:.....|:.|        .|||    |:::|:|| 
 Frog   120 PQCVCVFNTAVCGSDGKTYSQLCKFKE-VANAHPGANLTVVHDGPCESAPQILSPPYDIWNITG- 182

  Fly   335 RTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAER 399
              |:....|.....|..:|.:|:.|. |....|   |||.|.::.....::.|.||.|:|.:...
 Frog   183 --KDAIFGCEVFAYPMASIEWRKDGA-EMLLPG---DDPHISVQFRGGPQKYEVTGWLQIQSVRT 241

  Fly   400 SDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKEL 436
            ||:|.|:|:|:||..:......:|| ..||..:|..|
 Frog   242 SDEGTYKCLAKNKIGEVMAGATLTV-ITPDQLNMTGL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353
Ig 139..209 CDD:472250
Ig strand B 156..159 CDD:409353
Ig strand C 168..172 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
IgI_4_MYLK-like 229..319 CDD:409568 10/36 (28%)
Ig strand A 229..232 CDD:409568
Ig strand A' 238..241 CDD:409568
Ig strand B 246..254 CDD:409568
Ig strand C 260..264 CDD:409568
Ig strand C' 267..270 CDD:409568
Ig strand D 277..281 CDD:409568
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 3/7 (43%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 28/93 (30%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353
Ig strand B 447..451 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 487..491 CDD:409353
Ig strand F 501..506 CDD:409353
FN3 525..619 CDD:238020
FN3 640..735 CDD:238020
kazald1NP_001093733.1 IGFBP 53..105 CDD:459717
KAZAL <130..164 CDD:197624 9/34 (26%)
I-set 168..266 CDD:400151 32/104 (31%)
Ig strand B 185..189 CDD:409353 0/3 (0%)
Ig strand C 198..202 CDD:409353 1/3 (33%)
Ig strand E 223..236 CDD:409353 4/12 (33%)
Ig strand F 246..251 CDD:409353 2/4 (50%)
Ig strand G 259..262 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.