DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and ncam1

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_017951446.2 Gene:ncam1 / 100038291 XenbaseID:XB-GENE-923171 Length:1119 Species:Xenopus tropicalis


Alignment Length:838 Identity:224/838 - (26%)
Similarity:355/838 - (42%) Gaps:103/838 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKG 129
            :|:.|.......:|      ||..:......|.:..|.|.::|.:..|.|.|.|| :.||...:|
 Frog    71 SDISWYSPAGEKLL------NQQQISVVKNDGYTSTLTIYNVSSQDAGIYKCVAS-SETEGESEG 128

  Fly   130 -VTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNG-DPIRTTNDKYVVQTNGL 192
             |.:|.|..:|:.|||..|....|:|.|::|:|.:.....|.|...| |.|...:.::||.:|..
 Frog   129 TVNLKIYQ
KLTFKNAPTPQEFIEGEDAVIICDVSSSIPSIITWRHRGKDVILKKDVRFVVLSNNY 193

  Fly   193 L-IRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIIS--LPTNLEAVEGKPFAANCTAR 254
            | ||.|:::|||.|.|...::..||:..:.|.|.|.:.|.:.:  :..|..|...:....:|.|.
 Frog   194 LQIRGVKKTDEGTYRCE
GRILARGEINYKDIHVIVNVPPTVQARQIRVNATANMDESVVLSCDAD 258

  Fly   255 GKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNV 319
            |.|.|||||::....:... .::...|.....:||..|.:||...|:|:|.|:||..:....|.|
 Frog   259 GFPDPEISWLKKGEPIEDG-EEKISFNEDKSEMTIYRVGKDDEAEYSCIANNKAGEAEAIILLKV 322

  Fly   320 LVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFR---RWGTQEEYTNGQQDDDPRIILEPNF 381
            ..:|:|..:.|.|.....||.:||.|.|.|.|:|::|   |..:.||.|.     |..|:::.:.
 Frog   323 YAKPKITYVENKTAVELDEITLTCEASGDPIPSISWRTATRNISSEEKTL-----DGHIVVKEHI 382

  Fly   382 DEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRK 446
                  ....|.:.:.:.:|.|.|.|||.|...:..:..:..|::||   .:|....|::||...
 Frog   383 ------RMSALTLKDIQYTDAGEYICIASNAIGEDMRAMYFEVQYAP---KIKGPVVVYTWEGNP 438

  Fly   447 ANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHG 511
            .|::|..:..|:|.:.|..:|:.:.....:|:||......|.|.|:|.:...:..|.|.|.|..|
 Frog   439 VNITCEVLAYPSAVVSWFRDGQLLPSSNFSNIKIYSGPSSSSLEVNPDSENDFGNYNCTAVNSIG 503

  Fly   512 TAEHDMQLKEARVPDFVSEAKPSQLTATTMT-FDIRGPSTELGLPILAYSVQYKEALNPDWSTAY 575
            ....:..|.:|..|...:..:....::|.|. ||  .|....|:|||.|..::|......|...|
 Frog   504 HESSEFILVQADTPSSPAILRVEPYSSTVMVIFD--EPDATGGVPILKYKAEWKVIGQEKWHAKY 566

  Fly   576 --NRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHD 638
              .:..|.:|...|.||:|:|.|..:.:|.|..|||:       |||.:....:|..:..| |.:
 Frog   567 YDAKEVSAESIITVTGLKPETSYLVKLSAVNGKGLGD-------STPSQEFTTQPVNIAKP-QGE 623

  Fly   639 KEEPVVV---SPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTW-TELENSCNTVEVMETT 699
            ...|.:|   :...::.::......|.|.||..|.:.|  ....:..| .|:....::..||   
 Frog   624 PSAPKLVWHLNEDGNNVKVEIIKQDDGGSPIRHYLVNY--RALNAADWKPEMRVPSSSHHVM--- 683

  Fly   700 SFEMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTR--GIDVIQVAERQVFSSAAIVGIAIGGV 762
               :..|..|..|.:.:.|.|..|.|.||.:..:||.  .......:......:.|||||.|...
 Frog   684 ---LKALEWNVEYEVIVVAENQQGKSKPARLSFRTTAKPTATTATTSASAGLGTGAIVGILIVIF 745

  Fly   763 LLLLFVVDLLC----------CITVHMGVMATMCRKAKRSPSEID----------DEAKLGSLYG 807
            :|||.|||:.|          ||.|:      .|.||.......|          ||:|      
 Frog   746 VLLLVVVDVTCFFLNKCGLLMCIAVN------FCGKAGPGAKGKDIEEGKAAFSKDESK------ 798

  Fly   808 WRFPLPYCSGQLVKEPPPSPLPLPPPVKLGGSPMSTPLDEKEPLRTPTGSIKQNSTIE 865
                .|....:..:|..|:.         .||....| :|..||..|.......:|:|
 Frog   799 ----EPIVEVRTEEERTPNH---------DGSNQIEP-NETTPLTEPEHPADTTATVE 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 18/68 (26%)
IG_like 144..226 CDD:214653 28/83 (34%)
IGc2 152..209 CDD:197706 22/58 (38%)
I-set 230..319 CDD:254352 25/90 (28%)
IGc2 243..309 CDD:197706 19/65 (29%)
IG_like 330..424 CDD:214653 26/96 (27%)
IGc2 339..412 CDD:197706 22/75 (29%)
Ig 447..518 CDD:143165 18/70 (26%)
fn3 534..611 CDD:278470 26/79 (33%)
FN3 640..735 CDD:238020 21/98 (21%)
ncam1XP_017951446.2 Ig 43..136 CDD:416386 19/71 (27%)
Ig strand A 43..48 CDD:409353
Ig strand A' 51..55 CDD:409353
Ig strand B 57..67 CDD:409353
Ig strand C 71..77 CDD:409353 2/5 (40%)
Ig strand C' 80..82 CDD:409353 0/1 (0%)
Ig strand D 89..95 CDD:409353 0/5 (0%)
Ig strand E 97..105 CDD:409353 2/7 (29%)
Ig strand F 112..120 CDD:409353 5/8 (63%)
Ig strand G 124..135 CDD:409353 3/10 (30%)
IG 144..210 CDD:214652 23/65 (35%)
IgI_3_NCAM-1 231..325 CDD:143207 26/94 (28%)
Ig strand B 251..255 CDD:143207 0/3 (0%)
Ig strand C 264..268 CDD:143207 3/3 (100%)
Ig strand E 288..292 CDD:143207 0/3 (0%)
Ig strand F 302..307 CDD:143207 2/4 (50%)
Ig strand G 315..318 CDD:143207 0/2 (0%)
Ig 324..419 CDD:416386 28/105 (27%)
Ig strand A 324..329 CDD:409353 1/4 (25%)
Ig strand A' 333..337 CDD:409353 2/3 (67%)
Ig strand B 341..349 CDD:409353 4/7 (57%)
Ig strand C 355..361 CDD:409353 2/5 (40%)
Ig strand C' 364..367 CDD:409353 0/2 (0%)
Ig strand D 375..381 CDD:409353 1/5 (20%)
Ig strand E 384..390 CDD:409353 1/5 (20%)
Ig strand F 398..406 CDD:409353 5/7 (71%)
Ig strand G 409..419 CDD:409353 0/9 (0%)
Ig_3 423..500 CDD:404760 21/79 (27%)
Ig strand B 439..443 CDD:409353 1/3 (33%)
Ig strand C 452..456 CDD:409353 0/3 (0%)
Ig strand E 479..483 CDD:409353 2/3 (67%)
Ig strand F 493..498 CDD:409353 2/4 (50%)
FN3 517..612 CDD:238020 30/103 (29%)
FN3 624..709 CDD:238020 19/92 (21%)
Herpes_BLLF1 <776..>1116 CDD:282904 17/87 (20%)
PRK07994 <918..1075 CDD:236138
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40754
Inparanoid 1 1.050 242 1.000 Inparanoid score I3235
OMA 1 1.010 - - QHG48678
OrthoDB 1 1.010 - - D129648at2759
OrthoFinder 1 1.000 - - FOG0002001
OrthoInspector 1 1.000 - - otm48806
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.