DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tip60 and SAMD1

DIOPT Version :9

Sequence 1:NP_001259234.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_612361.1 Gene:SAMD1 / 90378 HGNCID:17958 Length:538 Species:Homo sapiens


Alignment Length:230 Identity:54/230 - (23%)
Similarity:70/230 - (30%) Gaps:77/230 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQ-HPGSGALAAIPQTPTGASGSVPPPAG 143
            :||.|||         |.|.|          :.|.:|: .|.:.|.||.|.||      .|||..
Human    98 RVQPPRR---------GATPP----------APPRAPRGAPAAAAAAAPPPTP------APPPPP 137

  Fly   144 IPNSVAPPG-----------TPSSGGELVNGNN------LAA---------ALQKRINRKRKNHG 182
            .|.:.|.|.           .|.|.|....|..      |||         |:......:|....
Human   138 APVAAAAPARAPRAAAAAATAPPSPGPAQPGPRAQRAAPLAAPPPAPAAPPAVAPPAGPRRAPPP 202

  Fly   183 GSAHGHHSL------TSQQQQSHPHPTTPQTPTATPVHVTGDGLISGAAND----------DGDG 231
            ..|.....|      .:..||..|.|..||.|..     .|.....|||..          .|.|
Human   203 AVAAREPPLPPPPQPPAPPQQQQPPPPQPQPPPE-----GGAVRAGGAARPVSLREVVRYLGGSG 262

  Fly   232 SQDGKTPTPRQSGSMVTHQDDVVTRMKNVEMIELG 266
            ...|:....|..|.:   :::...|.: :|...||
Human   263 GAGGRLTRGRVQGLL---EEEAAARGR-LERTRLG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tip60NP_001259234.1 Tudor-knot 23..78 CDD:288553
Drf_FH1 84..>157 CDD:283903 22/84 (26%)
PHA01732 139..>196 CDD:222828 17/88 (19%)
NAT_SF 254..533 CDD:302625 4/13 (31%)
MOZ_SAS 316..500 CDD:280097
SAMD1NP_612361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..247 44/178 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..458 4/13 (31%)
SAM_Atherin-like 459..527 CDD:188982
SAM 459..525 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.