DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tip60 and kat7a

DIOPT Version :9

Sequence 1:NP_001259234.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001070052.1 Gene:kat7a / 767644 ZFINID:ZDB-GENE-060929-168 Length:128 Species:Danio rerio


Alignment Length:124 Identity:27/124 - (21%)
Similarity:46/124 - (37%) Gaps:35/124 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 RKRKNHGGSAHG--------HHSLTSQQQQSHPHPTTPQT--------------PTATPVHVTGD 218
            |:::|.|.|:.|        .|: .|.:.::|....|..|              |...|.....:
Zfish     3 RRKRNAGSSSEGTEDSDFSAEHT-DSSESEAHVVRNTRLTRSSLRLSRSSQDASPVRNPTAPVSE 66

  Fly   219 GLISGAANDDGDGSQDGKTPTP-----RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKP 272
            .:::.:........|.|.|.:|     |||.|..:..:      ::.|:.|.||.| ||
Zfish    67 EVVNYSTRRVTRSQQQGATVSPKKYPLRQSRSSGSDTE------QHGEISERGRRR-KP 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tip60NP_001259234.1 Tudor-knot 23..78 CDD:288553
Drf_FH1 84..>157 CDD:283903
PHA01732 139..>196 CDD:222828 7/27 (26%)
NAT_SF 254..533 CDD:302625 7/19 (37%)
MOZ_SAS 316..500 CDD:280097
kat7aNP_001070052.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.