DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tip60 and Samd1

DIOPT Version :10

Sequence 1:NP_572151.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001074884.1 Gene:Samd1 / 666704 MGIID:2142433 Length:519 Species:Mus musculus


Alignment Length:183 Identity:41/183 - (22%)
Similarity:51/183 - (27%) Gaps:72/183 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPGSGALAAIPQTPTGASGSVPPPAG- 143
            :||.|||         |.|.|.......|..:.|.....|....:||..:.|..|:.:.||..| 
Mouse    98 RVQPPRR---------GATPPAPPRVPRGGPAAPPPTPAPPPAPVAAPTRAPRAAAATAPPSPGP 153

  Fly   144 ---------------------IPNSVAPPGTPSSGGELVNGNNLAAALQKRINRKRKNHGGSAHG 187
                                 .|.:.|||..|                      :|......|..
Mouse   154 AQPGPRAQRAAPLAAPPPAPAAPPAAAPPAGP----------------------RRAPPPAVAAR 196

  Fly   188 HHSLTSQQQQSHPHPTTPQTP----------TATPV-------HVTGDGLISG 223
            ......||||  |.|..||.|          .|.||       ::.|.|..||
Mouse   197 EPPAPPQQQQ--PPPPQPQPPPEGGAARAGGPARPVSLREVVRYLGGSGGASG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tip60NP_572151.1 CBD_TIP60_like 27..90 CDD:350848 5/9 (56%)
PLN00104 <255..533 CDD:215056
Samd1NP_001074884.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..232 37/166 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..381
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 417..439
SAM_Atherin-like 440..508 CDD:188982
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.