DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tip60 and e(y)3

DIOPT Version :9

Sequence 1:NP_001259234.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster


Alignment Length:267 Identity:58/267 - (21%)
Similarity:83/267 - (31%) Gaps:90/267 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPGSGALAAIPQTPTGASGSVPPPAGI--------- 144
            |.:.||:|....|:   :.|           |||:.:.:|.| |..|.|.|.|..|         
  Fly  1046 SSSSTSSGAAANQQ---VIG-----------GSGSSSMLPPT-TILSSSDPLPDVIFQPNDFSSI 1095

  Fly   145 ----------PNSVAPPGTPSSGGELVNGNNLAAALQKR-IN------------------RKRKN 180
                      |:|::...|..|..:..:.:|..:||... :|                  |.|::
  Fly  1096 MATQQLRSSRPSSISCGSTGGSQPDCHDEDNYTSALDNSGVNSSSSDETALPMPPTRGRGRGRRS 1160

  Fly   181 HGGSAHGHHSLTSQQQQSHPHPTTPQTPTATPVHVTGDGLISGAANDDGDGSQDGKTPTPRQSGS 245
            .||...|..|:...........|||.|....|....|...::.|.          ....||..|.
  Fly  1161 RGGRGRGSSSVDRAVSVGGTASTTPATQPRAPRMSRGASAVAKAI----------AMSRPRCVGG 1215

  Fly   246 MVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSK 310
            : .||.| ..|:|.:              |||.||           .|....|.|......:.|.
  Fly  1216 L-KHQPD-PERLKGL--------------FSPSPQ-----------VFEEDTRMSADLSNSNQSM 1253

  Fly   311 CNLRHPP 317
            .:|..||
  Fly  1254 ASLMEPP 1260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tip60NP_001259234.1 Tudor-knot 23..78 CDD:288553
Drf_FH1 84..>157 CDD:283903 20/86 (23%)
PHA01732 139..>196 CDD:222828 17/94 (18%)
NAT_SF 254..533 CDD:302625 14/64 (22%)
MOZ_SAS 316..500 CDD:280097 2/2 (100%)
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600
RanBP2-type Zn finger 1700..1725 CDD:275375
RanBP2-type Zn finger 1749..1775 CDD:275375
PHD2_PHF10 1756..1799 CDD:277004
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.