Sequence 1: | NP_001259234.1 | Gene: | Tip60 / 31362 | FlyBaseID: | FBgn0026080 | Length: | 541 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259719.1 | Gene: | e(y)3 / 32965 | FlyBaseID: | FBgn0087008 | Length: | 2012 | Species: | Drosophila melanogaster |
Alignment Length: | 267 | Identity: | 58/267 - (21%) |
---|---|---|---|
Similarity: | 83/267 - (31%) | Gaps: | 90/267 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 SQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPGSGALAAIPQTPTGASGSVPPPAGI--------- 144
Fly 145 ----------PNSVAPPGTPSSGGELVNGNNLAAALQKR-IN------------------RKRKN 180
Fly 181 HGGSAHGHHSLTSQQQQSHPHPTTPQTPTATPVHVTGDGLISGAANDDGDGSQDGKTPTPRQSGS 245
Fly 246 MVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSK 310
Fly 311 CNLRHPP 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tip60 | NP_001259234.1 | Tudor-knot | 23..78 | CDD:288553 | |
Drf_FH1 | 84..>157 | CDD:283903 | 20/86 (23%) | ||
PHA01732 | 139..>196 | CDD:222828 | 17/94 (18%) | ||
NAT_SF | 254..533 | CDD:302625 | 14/64 (22%) | ||
MOZ_SAS | 316..500 | CDD:280097 | 2/2 (100%) | ||
e(y)3 | NP_001259719.1 | PHD_SF | 1700..1754 | CDD:304600 | |
RanBP2-type Zn finger | 1700..1725 | CDD:275375 | |||
RanBP2-type Zn finger | 1749..1775 | CDD:275375 | |||
PHD2_PHF10 | 1756..1799 | CDD:277004 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45463879 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |