DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tip60 and samd1b

DIOPT Version :9

Sequence 1:NP_001259234.1 Gene:Tip60 / 31362 FlyBaseID:FBgn0026080 Length:541 Species:Drosophila melanogaster
Sequence 2:XP_005163590.1 Gene:samd1b / 101884198 ZFINID:ZDB-GENE-090313-2 Length:626 Species:Danio rerio


Alignment Length:312 Identity:62/312 - (19%)
Similarity:101/312 - (32%) Gaps:90/312 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CRLPVRMHKTD-DWPLAEIVS-IKELDGRRQFYVHYVDFNKRLDEWVNEEDLYTRKVQFPRR--- 86
            ||:..|.|.:| |...||:.. |:|....:..|...:.:..            ..|||...|   
Zfish    30 CRMVRRRHGSDPDQTRAELEKLIQEQTVLKVSYKGSISYRN------------AAKVQRKCRKRP 82

  Fly    87 ---DGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPGSGALAAIPQTPTGASGSVPPPAGIPNSV 148
               ..|.:|:...|....:|.:...:          |..||:...|....:....|....:..|.
Zfish    83 EQTTDSSSGSGESVAEQTKHAAFTNT----------GDSALSLTDQEEEESGDKEPEEPRVSPSP 137

  Fly   149 APP--GTPS------------SGGELVN--------GNNLAAALQKRINRKRKNHGGS------- 184
            .||  .:||            ||..||:        |:..|:|.::|.:......|||       
Zfish   138 DPPLQSSPSTLEKEDKILPLHSGNSLVSCGATGCSAGSEKASASKERRSVSAAGGGGSGPRDASS 202

  Fly   185 ------AHGHHSLTSQQQQ--------SHPHPTTPQTPTATPVHVTGDGLISGA------ANDDG 229
                  :.||.....::::        |.|.......|:.....|.|.. :.|:      :.|.|
Zfish   203 AGEEMLSAGHEGTDEEEEKEQKTCSSVSSPQKNRLSAPSKLKPGVKGSA-VRGSDSPEENSTDLG 266

  Fly   230 DGSQDG-KTPTPRQSGSMVTHQD---------DVVTRMKNVEMIELGRHRIK 271
            |...|. ::.:.|..||..|...         |.:...|.:...:|.|:|:|
Zfish   267 DRLMDAVRSMSERHRGSAATRGHAPPGLKEILDYLCTQKGMPGEKLTRNRVK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tip60NP_001259234.1 Tudor-knot 23..78 CDD:288553 11/52 (21%)
Drf_FH1 84..>157 CDD:283903 15/92 (16%)
PHA01732 139..>196 CDD:222828 19/91 (21%)
NAT_SF 254..533 CDD:302625 5/18 (28%)
MOZ_SAS 316..500 CDD:280097
samd1bXP_005163590.1 SAM_Atherin-like 550..618 CDD:188982
SAM 550..617 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.