DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and tmsb1

DIOPT Version :10

Sequence 1:NP_525065.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001159390.1 Gene:tmsb1 / 798430 ZFINID:ZDB-GENE-030131-8575 Length:46 Species:Danio rerio


Alignment Length:38 Identity:24/38 - (63%)
Similarity:27/38 - (71%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQA 129
            |...|.::|||.|.||.|.|.|||||||||.||.||:|
Zfish     4 NPVKAEVQNFDKKCLKKTNTEEKNVLPTKEDIEQEKKA 41

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
cibNP_525065.1 Thymosin 10..53 CDD:396038