DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and tmsb4x

DIOPT Version :10

Sequence 1:NP_525065.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001124169.1 Gene:tmsb4x / 793949 ZFINID:ZDB-GENE-030131-8304 Length:44 Species:Danio rerio


Alignment Length:33 Identity:21/33 - (63%)
Similarity:26/33 - (78%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EGITAFNQNNLKHTETNEKNPLPDKEAIEQEKE 90
            |.:|:|::..||.|||.||||||.||.|||||:
Zfish     8 EEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQ 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_525065.1 Thymosin 10..53 CDD:396038
Thymosin 57..93 CDD:421525 21/33 (64%)
Thymosin 98..129 CDD:396038
tmsb4xNP_001124169.1 Thymosin 3..41 CDD:396038 21/33 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.