DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and tmsb4x

DIOPT Version :9

Sequence 1:NP_001245516.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001124169.1 Gene:tmsb4x / 793949 ZFINID:ZDB-GENE-030131-8304 Length:44 Species:Danio rerio


Alignment Length:33 Identity:21/33 - (63%)
Similarity:26/33 - (78%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EGITAFNQNNLKHTETNEKNPLPDKEAIEQEKE 90
            |.:|:|::..||.|||.||||||.||.|||||:
Zfish     8 EEVTSFDKTKLKKTETQEKNPLPSKETIEQEKQ 40

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_001245516.1 Thymosin 10..53 CDD:396038
Thymosin 57..93 CDD:421525 21/33 (64%)
Thymosin 98..129 CDD:396038
tmsb4xNP_001124169.1 Thymosin 3..41 CDD:396038 21/33 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12004
eggNOG 1 0.900 - - E1_KOG4794
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto38850
orthoMCL 1 0.900 - - OOG6_103877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5020
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.