DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and Tmsb15a

DIOPT Version :10

Sequence 1:NP_525065.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:XP_006528691.1 Gene:Tmsb15a / 78478 MGIID:1925728 Length:79 Species:Mus musculus


Alignment Length:34 Identity:18/34 - (52%)
Similarity:23/34 - (67%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128
            ::.:|.||..|||.|.|..||.||:||.||.||:
Mouse    41 LSEVERFDKSKLKKTITEVKNTLPSKETIEQEKE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_525065.1 Thymosin 10..53 CDD:396038
Thymosin 57..93 CDD:421525
Thymosin 98..129 CDD:396038 18/31 (58%)
Tmsb15aXP_006528691.1 Thymosin 37..73 CDD:396038 16/31 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.