DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and TMSB4X

DIOPT Version :10

Sequence 1:NP_525065.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_066932.1 Gene:TMSB4X / 7114 HGNCID:11881 Length:44 Species:Homo sapiens


Alignment Length:35 Identity:24/35 - (68%)
Similarity:26/35 - (74%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQA 129
            :|.||.||..|||.|||.|||.||:||.||.||||
Human     7 MAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQA 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_525065.1 Thymosin 10..53 CDD:396038
Thymosin 57..93 CDD:421525
Thymosin 98..129 CDD:396038 21/30 (70%)
TMSB4XNP_066932.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 24/35 (69%)
Thymosin 3..41 CDD:396038 22/33 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.