| Sequence 1: | NP_525065.1 | Gene: | cib / 31359 | FlyBaseID: | FBgn0026084 | Length: | 129 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_066932.1 | Gene: | TMSB4X / 7114 | HGNCID: | 11881 | Length: | 44 | Species: | Homo sapiens |
| Alignment Length: | 35 | Identity: | 24/35 - (68%) |
|---|---|---|---|
| Similarity: | 26/35 - (74%) | Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 IAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQA 129 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cib | NP_525065.1 | Thymosin | 10..53 | CDD:396038 | |
| Thymosin | 57..93 | CDD:421525 | |||
| Thymosin | 98..129 | CDD:396038 | 21/30 (70%) | ||
| TMSB4X | NP_066932.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..44 | 24/35 (69%) | |
| Thymosin | 3..41 | CDD:396038 | 22/33 (67%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||