DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and Tmsb15l

DIOPT Version :10

Sequence 1:NP_525065.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_997150.1 Gene:Tmsb15l / 399591 MGIID:3026988 Length:80 Species:Mus musculus


Alignment Length:86 Identity:33/86 - (38%)
Similarity:49/86 - (56%) Gaps:8/86 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKHTE 72
            :.|.|.:     |::|.|::.|||..:|:.|..||:.|:..::|...|..|   .|::..||.|.
Mouse     1 MSDKPDL-----SEVETFDKSKLKKTNTEVKNTLPSNENKMSDKPDLSEVE---TFDKAKLKKTN 57

  Fly    73 TNEKNPLPDKEAIEQEKEKNQ 93
            |..||.||.||.|:||||.|:
Mouse    58 TEVKNTLPSKETIQQEKEHNE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_525065.1 Thymosin 10..53 CDD:396038 14/42 (33%)
Thymosin 57..93 CDD:421525 17/35 (49%)
Thymosin 98..129 CDD:396038
Tmsb15lNP_997150.1 Thymosin 3..39 CDD:421525 13/40 (33%)
Thymosin 38..76 CDD:396038 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.