DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and Tmsb15b2

DIOPT Version :9

Sequence 1:NP_001245516.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_775435.1 Gene:Tmsb15b2 / 286978 RGDID:708373 Length:45 Species:Rattus norvegicus


Alignment Length:34 Identity:19/34 - (55%)
Similarity:24/34 - (70%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQ 93
            :..|:::.||.|.|.|||.||.||.|:||||.||
  Rat    10 VETFDKSKLKKTNTEEKNTLPSKETIQQEKEYNQ 43

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_001245516.1 Thymosin 10..53 CDD:396038
Thymosin 57..93 CDD:421525 17/32 (53%)
Thymosin 98..129 CDD:396038
Tmsb15b2NP_775435.1 Thymosin 3..39 CDD:396038 14/28 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11658
eggNOG 1 0.900 - - E1_KOG4794
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103877
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.