powered by:
Protein Alignment cib and Tmsb10
DIOPT Version :9
Sequence 1: | NP_001245516.1 |
Gene: | cib / 31359 |
FlyBaseID: | FBgn0026084 |
Length: | 129 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001034481.1 |
Gene: | Tmsb10 / 19240 |
MGIID: | 109146 |
Length: | 44 |
Species: | Mus musculus |
Alignment Length: | 32 |
Identity: | 21/32 - (65%) |
Similarity: | 24/32 - (75%) |
Gaps: | 0/32 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 IENFDAKKLKHTETNEKNVLPTKEVIEAEKQA 129
|.:||..|||.|||.|||.|||||.||.||::
Mouse 10 IASFDKAKLKKTETQEKNTLPTKETIEQEKRS 41
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
47 |
1.000 |
Domainoid score |
I11917 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4794 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.