DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and Tmsb10

DIOPT Version :9

Sequence 1:NP_001245516.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001034481.1 Gene:Tmsb10 / 19240 MGIID:109146 Length:44 Species:Mus musculus


Alignment Length:32 Identity:21/32 - (65%)
Similarity:24/32 - (75%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IENFDAKKLKHTETNEKNVLPTKEVIEAEKQA 129
            |.:||..|||.|||.|||.|||||.||.||::
Mouse    10 IASFDKAKLKKTETQEKNTLPTKETIEQEKRS 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_001245516.1 Thymosin 10..53 CDD:396038
Thymosin 57..93 CDD:421525
Thymosin 98..129 CDD:396038 21/30 (70%)
Tmsb10NP_001034481.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 21/32 (66%)
Thymosin 3..41 CDD:396038 21/30 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11917
eggNOG 1 0.900 - - E1_KOG4794
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.