DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cib and tth-1

DIOPT Version :9

Sequence 1:NP_001245516.1 Gene:cib / 31359 FlyBaseID:FBgn0026084 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_509430.1 Gene:tth-1 / 181097 WormBaseID:WBGene00006649 Length:151 Species:Caenorhabditis elegans


Alignment Length:122 Identity:49/122 - (40%)
Similarity:65/122 - (53%) Gaps:4/122 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALKDLPKVAENLKSQL-EGFNQDKLKNASTQEKIILPTAEDVAAEKTQQSIFEGITAFNQNNLKH 70
            |:.:|||:.:.|...: ||.   :||...|.||.:|||.||||.||........|..|:...|..
 Worm     3 AVTELPKMNQELAGAVREGL---ELKKVETTEKNVLPTKEDVAEEKQHVERIHEIEHFDSTKLHS 64

  Fly    71 TETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEK 127
            |...||..||..:.|:|||:..:....|.||.::.||.|||.||||||:...:..||
 Worm    65 TPVKEKIVLPSADDIKQEKQHLELTDKINNFPSENLKKTETIEKNVLPSPTDVAREK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cibNP_001245516.1 Thymosin 10..53 CDD:396038 20/43 (47%)
Thymosin 57..93 CDD:421525 12/35 (34%)
Thymosin 98..129 CDD:396038 16/30 (53%)
tth-1NP_509430.1 Thymosin <22..47 CDD:279614 14/27 (52%)
THY 51..87 CDD:128457 12/35 (34%)
THY 89..125 CDD:128457 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4794
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I3828
Isobase 1 0.950 - 0 Normalized mean entropy S5310
OMA 1 1.010 - - QHG45657
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto18335
orthoMCL 1 0.900 - - OOG6_103877
Panther 1 1.100 - - LDO PTHR20940
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5020
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.