| Sequence 1: | NP_525065.1 | Gene: | cib / 31359 | FlyBaseID: | FBgn0026084 | Length: | 129 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001074436.1 | Gene: | Tmsb15b2 / 100034363 | MGIID: | 3843061 | Length: | 45 | Species: | Mus musculus |
| Alignment Length: | 34 | Identity: | 17/34 - (50%) |
|---|---|---|---|
| Similarity: | 23/34 - (67%) | Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 95 IAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cib | NP_525065.1 | Thymosin | 10..53 | CDD:396038 | |
| Thymosin | 57..93 | CDD:421525 | |||
| Thymosin | 98..129 | CDD:396038 | 17/31 (55%) | ||
| Tmsb15b2 | NP_001074436.1 | Thymosin | 3..41 | CDD:396038 | 17/34 (50%) |
| Blue background indicates that the domain is not in the aligned region. | |||||