DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3galnt2

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001349333.1 Gene:B3galnt2 / 97884 MGIID:2145517 Length:504 Species:Mus musculus


Alignment Length:197 Identity:43/197 - (21%)
Similarity:74/197 - (37%) Gaps:35/197 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ESREHGDILQAEFTDAYFNNTLKTMLGMRWA--SDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGR 193
            ||..|.||:..:..|.|.|...|.:...||.  |..|   :..|..|||.|:..:.|...:.: :
Mouse   315 ESSVHDDIVFVDVVDTYRNVPAKLLNFYRWTVESTSF---DLLLKTDDDCYIDLEAVFNRIAQ-K 375

  Fly   194 QSHQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLP 258
            ....|...:..  |:.:....:..||...  |||...:|.:.....:::|:..:..|...|..|.
Mouse   376 NLDGPNFWWGN--FRLNWAVDRTGKWQEL--EYPSPAYPAFACGSGYVISKDIVDWLAGNSRRLK 436

  Fly   259 LFRFDDVYLGIVALKAG---------ISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMTR 314
            .::.:||.:||.....|         :..:.|:......|.|                .|||:::
Mouse   437 TYQGEDVSMGIWMAAIGPKRHQDSLWLCEKTCETGMLSSPQY----------------SPEELSK 485

  Fly   315 VW 316
            :|
Mouse   486 LW 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 36/161 (22%)
B3galnt2NP_001349333.1 Galactosyl_T <330..459 CDD:328824 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847377
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.