DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3gnt9

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001258844.1 Gene:B3gnt9 / 97440 MGIID:2142841 Length:399 Species:Mus musculus


Alignment Length:203 Identity:73/203 - (35%)
Similarity:103/203 - (50%) Gaps:17/203 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVA-----W------ESR 133
            |.:.:||...:..||||:|:|||.|||.....:|||||||..:.:....|     |      |||
Mouse   120 LLIAVKSVAADFERREAVRQTWGAEGRVQGALVRRVFLLGVPKGAGSGGAGTRSHWRTLLEAESR 184

  Fly   134 EHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQP 198
            .:.|||...|.|.:||.|||.:..:.|||.......|....|.|.:|..:|:|:||    :...|
Mouse   185 AYADILLWAFEDTFFNLTLKEIHFLSWASAFCPDVHFVFKGDADVFVHVRNLLQFL----ELRDP 245

  Fly   199 --ELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFR 261
              :||....:.|..|:|.:.||:::....|....:|.|...|.|:||...||:|..|...:.||.
Mouse   246 AQDLLAGDVIVQARPIRARASKYFIPRAVYGLPVYPAYAGGGGFVLSGATLRRLADACSQVELFP 310

  Fly   262 FDDVYLGI 269
            .|||:||:
Mouse   311 IDDVFLGM 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 70/191 (37%)
B3gnt9NP_001258844.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..55
Galactosyl_T 132..331 CDD:389837 70/191 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847392
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3094
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.