Sequence 1: | NP_476901.1 | Gene: | brn / 31358 | FlyBaseID: | FBgn0000221 | Length: | 325 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258844.1 | Gene: | B3gnt9 / 97440 | MGIID: | 2142841 | Length: | 399 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 73/203 - (35%) |
---|---|---|---|
Similarity: | 103/203 - (50%) | Gaps: | 17/203 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 LTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTAEDSEKDVA-----W------ESR 133
Fly 134 EHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQP 198
Fly 199 --ELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFR 261
Fly 262 FDDVYLGI 269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
brn | NP_476901.1 | Galactosyl_T | 92..282 | CDD:250845 | 70/191 (37%) |
B3gnt9 | NP_001258844.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 35..55 | ||
Galactosyl_T | 132..331 | CDD:389837 | 70/191 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847392 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2287 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1037602at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3094 |
SonicParanoid | 1 | 1.000 | - | - | X41 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.780 |