DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GNT7

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_660279.1 Gene:B3GNT7 / 93010 HGNCID:18811 Length:401 Species:Homo sapiens


Alignment Length:258 Identity:85/258 - (32%)
Similarity:129/258 - (50%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTMLIKSAVGNSRRREAIRRTWGYE------GRFSDVHLRRVFLLGTAEDSEKD------VAWES 132
            |.:::||.:....||||||:|||.|      ||.:   :|.:||||||...|:.      :|:|.
Human   136 LLVVVKSVITQHDRREAIRQTWGRERQSAGGGRGA---VRTLFLLGTASKQEERTHYQQLLAYED 197

  Fly   133 REHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQ 197
            |.:|||||..|.|.:||.|||.:..::|.........|....|||.:|:..|:|:||.    ..|
Human   198 RLYGDILQWGFLDTFFNLTLKEIHFLKWLDIYCPHVPFIFKGDDDVFVNPTNLLEFLA----DRQ 258

  Fly   198 P-ELLFAGHVFQ-TSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLF 260
            | |.||.|.|.| ..|:|.|.:|:|:....|....:|||...|.|:::....|:|:.|...|.|:
Human   259 PQENLFVGDVLQHARPIRRKDNKYYIPGALYGKASYPPYAGGGGFLMAGSLARRLHHACDTLELY 323

  Fly   261 RFDDVYLGIVALKAGISLQHCDDFRF-------HRPAYKGPDSYSSVIASHEFGDPEEMTRVW 316
            ..|||:||:.....|:.....:.|:.       :....|.|..:.:::..|:. .|.|:..:|
Human   324 PIDDVFLGMCLEVLGVQPTAHEGFKTFGISRNRNSRMNKEPCFFRAMLVVHKL-LPPELLAMW 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 75/203 (37%)
B3GNT7NP_660279.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..62
Galactosyl_T 148..342 CDD:304462 75/200 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156989
Domainoid 1 1.000 131 1.000 Domainoid score I5138
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40700
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.