DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT1G77810

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001319398.1 Gene:AT1G77810 / 844443 AraportID:AT1G77810 Length:387 Species:Arabidopsis thaliana


Alignment Length:273 Identity:61/273 - (22%)
Similarity:121/273 - (44%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HYPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVD----QPAR---LTMLIKSAVGNSRRREAIR 98
            |..:.||       ..|||.......:.:::..||    .|.:   :.|.|.:|..:.:||:::|
plant    81 HEAIQDD-------RSLDKSVSTLSSTRSSQEMVDGSETNPRKKVFMVMGINTAFSSRKRRDSVR 138

  Fly    99 RTWGYEGRFSDVHLRRV---------FLLGTAEDS----EKDVAWESREHGDILQAEFTDAYFNN 150
            .||..:|.    .|.|:         |::|.:..|    ::.:..|..:|.|.|:.|..:.|...
plant   139 ETWMPQGE----KLERLEQEKGIVIKFMIGHSATSNSILDRAIDSEDAQHKDFLRLEHVEGYHEL 199

  Fly   151 TLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQTSPLRHK 215
            :.||.:....|..::: :|||:.||||.:|:...:...|.|.|...:   ::.| ..::.|:..:
plant   200 SAKTKIFFSTAVAKWD-AEFYIKVDDDVHVNLGMLASTLARHRSKPR---VYIG-CMKSGPVLAQ 259

  Fly   216 FSKWYVSLEEYPF----DRWPPYVTAGAFILSQKALRQLYAASVHLPL---FRFDDVYLGIVALK 273
            .:..|...|.:.|    :::..:.|...:.:|:.....:   |::.|:   :..:||.||  :..
plant   260 KTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYI---SINQPILHKYANEDVSLG--SWF 319

  Fly   274 AGISLQHCDDFRF 286
            .|:.::|.||..|
plant   320 IGLEVEHIDDRNF 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 46/209 (22%)
AT1G77810NP_001319398.1 PLN03193 6..384 CDD:178735 61/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.