DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT1G33430

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001185130.1 Gene:AT1G33430 / 840236 AraportID:AT1G33430 Length:403 Species:Arabidopsis thaliana


Alignment Length:262 Identity:60/262 - (22%)
Similarity:106/262 - (40%) Gaps:65/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RVPSFTAEVPVDQPARLTML-----IKSAVGNSRRREAIRRTWGYEGRFSDVHLRRV-------- 115
            |...|.:|......:||..:     |.:|..:.:||:::|:||...|.    .|:::        
plant   105 RSSEFWSERSAKNQSRLQKVFAVIGINTAFSSKKRRDSVRQTWMPTGE----KLKKIEKEKGIVV 165

  Fly   116 ---------FLLGTAEDS----EKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNR 167
                     |::|.:...    :|.:..|..||.|.|:.:..:.|...:.||.|....|:..:: 
plant   166 RKFGFLFDRFVIGHSATPGGVLDKAIDEEDSEHKDFLRLKHIEGYHQLSTKTRLYFSTATAMYD- 229

  Fly   168 SEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPEL----LFAGHVFQTSPLR-HKFSKWYVSLEEYP 227
            :|||:.||||.:|:...::..|  .|...:|.:    :.:|.|.....:: |:...|....|...
plant   230 AEFYVKVDDDVHVNLGMLVTTL--ARYQSRPRIYIGCMKSGPVLSQKGVKYHEPEFWKFGEEGNK 292

  Fly   228 FDRWPPYVTAGAFILSQKALRQLYAASVHLP---------LFRF--DDVYLGIVALKAGISLQHC 281
            :.|              .|..|:||.|..|.         |.|:  :||.||  |...|:.::|.
plant   293 YFR--------------HATGQIYAISKDLATYISTNQGILHRYANEDVSLG--AWMLGLEVEHV 341

  Fly   282 DD 283
            |:
plant   342 DE 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 52/226 (23%)
AT1G33430NP_001185130.1 PLN03193 7..401 CDD:178735 60/262 (23%)
DUF4094 7..103 CDD:290073
Galactosyl_T 138..342 CDD:304462 52/226 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.