DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and B3GNT5

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_114436.1 Gene:B3GNT5 / 84002 HGNCID:15684 Length:378 Species:Homo sapiens


Alignment Length:302 Identity:85/302 - (28%)
Similarity:151/302 - (50%) Gaps:19/302 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLTHLHELNFERHFH-YPLNDDTGSGSASSGLDKFAYLRVPSFTAEVPVDQPARLTMLIKSAVGN 90
            :::|:...::....: |...:||.|...:|...::.||.......:.   |...|.:.:|:|..|
Human    39 IVSHMKSYSYRYLINSYDFVNDTLSLKHTSAGPRYQYLINHKEKCQA---QDVLLLLFVKTAPEN 100

  Fly    91 SRRREAIRRTWGYEGRFS---DVHLRRVFLLGT-----AEDSEKDVAWESREHGDILQAEFTDAY 147
            ..||..||||||.|....   :.:::.:|.|||     .|:.::.:|||.:.:.||:|.:|.|::
Human   101 YDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSF 165

  Fly   148 FNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHVFQ-TSP 211
            :|.|||.::...||:.....::|.:..|||.::...|::::|....|....: .:.|.|.: ..|
Human   166 YNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSLEQIGVQD-FWIGRVHRGAPP 229

  Fly   212 LRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAAS--VHLPLFRFDDVYLGIVALKA 274
            :|.|.||:|||.|.|.:..:|.|....|:::|.....::|.||  ::..|: .|||::|:.|.|.
Human   230 IRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLY-IDDVFMGLCANKI 293

  Fly   275 GISLQHCDDFRFHRPAYKGPDSYSSVIASHEFGDPEEMTRVW 316
            ||..|....|.........|..|..::.||  |..|::..:|
Human   294 GIVPQDHVFFSGEGKTPYHPCIYEKMMTSH--GHLEDLQDLW 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 64/200 (32%)
B3GNT5NP_114436.1 Galactosyl_T 102..299 CDD:389837 63/198 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4482
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm40700
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3094
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.