DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT1G27120

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_174032.2 Gene:AT1G27120 / 839601 AraportID:AT1G27120 Length:673 Species:Arabidopsis thaliana


Alignment Length:338 Identity:82/338 - (24%)
Similarity:129/338 - (38%) Gaps:90/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HELNFERHFHYPLNDDTGSGSASSGLDKFAYLRV------PSFTAEVPVD------------QPA 78
            |..:|.....:.|.|.||. :....:|..:....      |||..:..::            :|.
plant   362 HITSFPYRTGFVLEDATGL-AVKGNIDVHSVYAASLPSTNPSFAPQKHLEMQRIWKAPSLPQKPV 425

  Fly    79 RLTMLIKSAVGNSRRREAIRRTWGYEG--RFSDVHLRRVFLLGTAEDSEKDVAWESREHGDILQA 141
            .|.:.|.||..:...|.|:|::|..:.  |.|.|..|....|...::...|:..|:...|||:..
plant   426 ELFIGILSAGNHFAERMAVRKSWMQQKLVRSSKVVARFFVALHARKEVNVDLKKEAEYFGDIVIV 490

  Fly   142 EFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVL----KFLGRGRQSHQPELLF 202
            .:.|.|....|||:....:..:.. .:::.:..|||.:|....|:    |..||       |.|:
plant   491 PYMDHYDLVVLKTVAICEYGVNTV-AAKYVMKCDDDTFVRVDAVIQEAEKVKGR-------ESLY 547

  Fly   203 AGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILS------------QKALRQLYAAS 254
            .|:: |...|||  ..||.|:.||:|.:.:|||.....:|||            ||.||      
plant   548 IGNINFNHKPLR--TGKWAVTFEEWPEEYYPPYANGPGYILSYDVAKFIVDDFEQKRLR------ 604

  Fly   255 VHLPLFRFDDVYLGIVALKAG--------ISLQHC------DDFRFHRPAYKGPDSYSSVIASHE 305
                ||:.:||.:|:...|..        .||:.|      |.|..|         |.|      
plant   605 ----LFKMEDVSMGMWVEKFNETRPVAVVHSLKFCQFGCIEDYFTAH---------YQS------ 650

  Fly   306 FGDPEEMTRVWNE 318
               |.:|..:|::
plant   651 ---PRQMICMWDK 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 59/222 (27%)
AT1G27120NP_174032.2 Gal-bind_lectin 187..391 CDD:278752 7/29 (24%)
Galactosyl_T 439..619 CDD:304462 55/199 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.