DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and DD46

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_564154.1 Gene:DD46 / 838806 AraportID:AT1G22015 Length:398 Species:Arabidopsis thaliana


Alignment Length:228 Identity:50/228 - (21%)
Similarity:99/228 - (43%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTWGYEGRFSDVHLRRV---------FLLGTAEDS----EKDVAWESREH 135
            |.:|..:.:||:::|.||..:|.    .|.::         |::|.:...    :|::..|..::
plant   132 INTAFSSRKRRDSLRETWMPQGE----KLEKLEKEKGIVVKFMIGHSSTPNSMLDKEIDSEDAQY 192

  Fly   136 GDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPEL 200
            .|..:.:..:.|:|.:.||......|..::: :|||:.:|||.:|:...:...|...|...:   
plant   193 NDFFRLDHVEGYYNLSAKTKSFFSSAVAKWD-AEFYVKIDDDVHVNLGTLASTLASHRSKPR--- 253

  Fly   201 LFAGHVFQTSPLRHKFSKWYVSLEEYPF-DRWPPYVTAGAFILSQKALRQLYAASVHL------- 257
            ::.| ..::.|:..|.:..|...|.:.| :....|.        :.|..|:||.|..|       
plant   254 VYIG-CMKSGPVLTKKTAKYREPEFWKFGEEGNKYF--------RHATGQIYAISKDLATYISNN 309

  Fly   258 -PL---FRFDDVYLGIVALKAGISLQHCDDFRF 286
             |:   :..:||.||  :...|:.::..||..|
plant   310 QPILHKYANEDVTLG--SWFIGLEVEQIDDRNF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 45/214 (21%)
DD46NP_564154.1 PLN03193 5..393 CDD:178735 50/228 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.