DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT1G11730

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_172638.1 Gene:AT1G11730 / 837717 AraportID:AT1G11730 Length:384 Species:Arabidopsis thaliana


Alignment Length:236 Identity:57/236 - (24%)
Similarity:100/236 - (42%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKSAVGNSRRREAIRRTWGYEGRFSDVHLRRV---------FLLGTAEDS----EKDVAWESREH 135
            |.:|..:.:||:::|.||..:|.    :|:::         |::|.:..|    :|.:..|.:.|
plant   121 INTAFSSRKRRDSVRSTWMPQGE----NLKKLEEEKGIIVRFVIGHSVLSHGILDKAIEAEEKTH 181

  Fly   136 GDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGR--------- 191
            ||.|:.|.|:.|...:.||......|...:: :|||:.||||.:|:..::.|.|..         
plant   182 GDFLRLEHTEGYMKLSAKTKTFFATAVSLWD-AEFYIKVDDDVHVNLASLKKALSAHQNKPRVYV 245

  Fly   192 ---------GRQS---HQPELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQ 244
                     .|:|   |:||....|.| .....||...::|...::           ...:||..
plant   246 GCMKSGPVLARKSVKYHEPEYWKFGEV-GNKYFRHATGQFYAISKD-----------LATYILIN 298

  Fly   245 KALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFR 285
            :.|...||.         :||.||  :...|::::|.|:.|
plant   299 QDLLHKYAN---------EDVSLG--SWFIGLNVEHVDEKR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 53/223 (24%)
AT1G11730NP_172638.1 PLN03193 1..382 CDD:178735 57/236 (24%)
DUF4094 18..96 CDD:290073
Galactosyl_T 129..325 CDD:304462 53/223 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.