DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT5G62620

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_201068.1 Gene:AT5G62620 / 836383 AraportID:AT5G62620 Length:681 Species:Arabidopsis thaliana


Alignment Length:346 Identity:81/346 - (23%)
Similarity:143/346 - (41%) Gaps:62/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PLILLVDYCGLLT--------HL-----HELNFERHFHYPLNDDTG-------------SGSASS 55
            |....||...:||        |:     |..:|.....:.|.|.||             :||..:
plant   341 PFPFTVDKLFVLTLSAGLEGYHVSVDGKHVTSFPYRTGFTLEDATGLTINGDIDVHSVFAGSLPT 405

  Fly    56 GLDKFA---YLRVPS-FTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEG--RFSDVHLRR 114
            ....|:   :|.:.| :.|....|:...:.:.|.||..:...|.|:||:|....  :.|.|..|.
plant   406 SHPSFSPQRHLELSSNWQAPSLPDEQVDMFIGILSAGNHFAERMAVRRSWMQHKLVKSSKVVARF 470

  Fly   115 VFLLGTAEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYY 179
            ...|.:.::...::..|:...|||:...:.|:|....|||:....:.:.|. .::|.:..|||.:
plant   471 FVALHSRKEVNVELKKEAEFFGDIVIVPYMDSYDLVVLKTVAICEYGAHQL-AAKFIMKCDDDTF 534

  Fly   180 VSAKNVLKFLGRGRQSHQPELLFAGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILS 243
            |....|   |...:::.....|:.|:: :...|||.  .||.|:.||:|.:.:|||.....:|||
plant   535 VQVDAV---LSEAKKTPTDRSLYIGNINYYHKPLRQ--GKWSVTYEEWPEEDYPPYANGPGYILS 594

  Fly   244 QKALRQLYAA-SVH-LPLFRFDDVYLG--IVALKAGI-------SLQHCDDFRFHRPAYKGPDSY 297
            ....|.:... ..| |.:|:.:||.:|  :.....|.       ||:.|.        :...::|
plant   595 NDISRFIVKEFEKHKLRMFKMEDVSVGMWVEQFNNGTKPVDYIHSLRFCQ--------FGCIENY 651

  Fly   298 SSVIASHEFGDPEEMTRVWNE 318
               :.:| :..|.:|..:|::
plant   652 ---LTAH-YQSPRQMICLWDK 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 53/203 (26%)
AT5G62620NP_201068.1 PLN03133 126..681 CDD:215596 81/346 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.