DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment brn and AT5G57500

DIOPT Version :9

Sequence 1:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_200558.1 Gene:AT5G57500 / 835854 AraportID:AT5G57500 Length:318 Species:Arabidopsis thaliana


Alignment Length:252 Identity:53/252 - (21%)
Similarity:96/252 - (38%) Gaps:61/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERHFHY--------PLNDDTGSGSASSGLD 58
            :|:.||      .::|....:....:|..::|:.|:....:        |:|    :||:.:.| 
plant     6 RSEGRK------FIIPSFFFIIALCVLAFINEIRFDSLLSFGRCALSNVPMN----NGSSETPL- 59

  Fly    59 KFAYLRVPSFTAEVPVDQPARLTMLIKSAVGNSRRREAIRRTWGYEGRFSD---VHLRRVFLLGT 120
                      .:..|||...|:.:.|.:......||..:|..:|.: ...|   |.::.||...|
plant    60 ----------LSSSPVDDEIRILIGILTLPDQYSRRHFLRMIYGTQ-NVPDGVKVDVKFVFCNLT 113

  Fly   121 AEDSEKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSE-------FYLFVDDDY 178
            .||.:..||.|...:.||:.....:..  |..||........|.||.::       :.:..|||.
plant   114 KEDQKVLVALEIMRYDDIIILNCNENM--NKGKTYTYFSSLPDIFNETDAQKPPYHYVMKADDDT 176

  Fly   179 YVSAKNVLKFLGRGRQSHQP---ELLFAGHVF---QTSPLRHKFS------KWYVSL 223
            |:..::::..|       :|   |.|:.|:|.   ...|..|..|      .|.:::
plant   177 YIRLESLVASL-------RPLPREDLYYGYVIPCPSMDPFVHYMSGMGYLVSWDIAV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 36/154 (23%)
AT5G57500NP_200558.1 Galactosyl_T 83..225 CDD:419759 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.